KEGG   Danio rerio (zebrafish): 559398
Entry
559398            CDS       T01004                                 

Symbol
cdca5
Name
(RefSeq) sororin
  KO
K17390  sororin
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dre03036]
    559398 (cdca5)
Chromosome and associated proteins [BR:dre03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Other sister chromatid cohesion factors
    559398 (cdca5)
SSDB
Motif
Pfam: Sororin
Other DBs
NCBI-GeneID: 559398
NCBI-ProteinID: NP_001094417
ZFIN: ZDB-GENE-030131-235
Ensembl: ENSDARG00000044437
Vega: OTTDARG00000018801
UniProt: A2BIB1
Position
5:complement(67175283..67180800)
AA seq 259 aa
MSTKTPRLTSRKSSDQIIKSNGKSPARRRSSRLSANDENLPSKVVPPPVAMKRSITVRKI
APRKTQALSNSNKENVERISEVSTKRSKVLTSSPAISAEPKTSVLSPILPSSSPPPQPTE
SEQDSVWSKKVRRSYSRLSMGDKSFESPRPARSSSPNNRESLFGFERLQTPEVMKKTEGS
RSAPLGFMSLSLGSFNLSAADESASNPPEVDPNIPGVCLGKKTTRRKRVQQIKMSELDVL
AAKMNAEFEEAESFELFVE
NT seq 780 nt   +upstreamnt  +downstreamnt
atgagcaccaaaacaccacgattaacatcgaggaaaagcagcgatcaaatcataaagtca
aatggaaagagtccagcacgaaggaggtccagcagattgtctgcaaatgatgagaatctg
ccatctaaagtggtgcctcctccagtggccatgaagcggtcgatcactgtgcggaaaatt
gcacccaggaaaacccaggccttgtctaacagtaacaaggagaacgtggagagaatatct
gaagtgtcaacaaagcgctccaaagtcttgacatcttcgccggccatatcagcagagccc
aagacatctgtcctgtctccaatcctcccgtcttcatctcctcctcctcagcccacagaa
tcagaacaggactctgtttggtccaagaaagtgcgacgctcctacagtcgcctcagtatg
ggggacaaatccttcgaaagtcccagacctgcccgttcctcttctccaaacaacagagag
tccctgtttggcttcgagcgtcttcagaccccagaggtgatgaagaagactgaagggtct
cgaagcgctcctctgggcttcatgtccctctctctgggttcttttaacctctctgctgct
gatgaaagcgcttctaaccctccagaggttgatccgaacatccctggtgtgtgtctgggg
aaaaagaccaccaggaggaagcgcgttcaacagataaagatgtcagagttggacgttctt
gctgccaagatgaacgctgagttcgaggaagctgaaagttttgaactgtttgttgaatga

DBGET integrated database retrieval system