KEGG   Danio rerio (zebrafish): 559473
Entry
559473            CDS       T01004                                 

Gene name
usp49
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 49
  KO
K11834  ubiquitin carboxyl-terminal hydrolase 44/49 [EC:3.4.19.12]
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dre01002]
    559473 (usp49)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dre04121]
    559473 (usp49)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     559473 (usp49)
Peptidases and inhibitors [BR:dre01002]
 Cysteine peptidases
  Family C19: ubiquitin-specific protease family
   559473 (usp49)
Ubiquitin system [BR:dre04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    559473 (usp49)
SSDB
Motif
Pfam: UCH zf-UBP UCH_1 PDCD7 zf-UBP_var
Other DBs
NCBI-GeneID: 559473
NCBI-ProteinID: NP_001038361
ZFIN: ZDB-GENE-050208-484
Ensembl: ENSDARG00000000229
Vega: OTTDARG00000009008
UniProt: Q1MTK1
Position
22
AA seq 649 aa
MDRCKHVVRFRLGHGHSILNPQMWRCVDCDTTESVWACLKCTHVACGRYMEEHSRSHYQQ
TQHPLAMDVRELDVFCFACGDYVLNDNVEGDLKLLRGALSTVRSPGQRSLRSSVTDGGLR
VCEITRDGAMQTALWHRRKTLLKSALRYWISRQQEEHRKREEKQEQEREEKRRQRKEVKK
RLLGELANVPPRKSARLLTQAPRPTIALIPRKFRDPPERLPAAPKQLLTLSAKTLSRKPL
RRTARLHRYHASQSARRRKLAPGVTGLRNLGNTCYMNSILQVLSHLQKFRECFLTLDLCE
TEELLAKSNHPQVGALSAGGGGGGGGVPSSLQSAEQKEPRSSSRQQVSLCHELHTLFRVM
WSGRWSLVSPFAMLHSVWNLIPAFRGYDQQDAQEFLCELLDKVQQELESDAPRKHFLIPI
TQRKLSKQVLKVLNTIFHGQLLSQVTCLSCKRKSNTVEPFWDLSLEFPERYHRMEKPSAA
ACQRSCSLSEMLAKFTETEALEGCIYACNFCNRKRRKSSHKPLSLSEACKQLLICRLPQV
LRLHLKRFRWSGRNHREKIGVHVAFDQVLNIQPYCSCSDAAAREAYTYDLSAVVMHHGKG
FGSGHYTAYCYNTEGGFWVHCNDSEMNVCSVEEVCSTQAYILFYTQRSS
NT seq 1950 nt   +upstreamnt  +downstreamnt
atggatcgctgtaagcacgtggtgcggttccgcctgggccacggccactccatcctcaac
ccgcagatgtggcgctgcgtggactgcgataccaccgagtccgtgtgggcctgcctgaag
tgcacgcacgtagcctgcggacgctacatggaggagcactcacggagccactaccagcag
actcagcatccgctagccatggatgtacgcgagctggatgtcttctgctttgcgtgcgga
gattacgtgttgaacgataacgtggagggcgatctcaagctcctgcggggggcgctgtcc
accgtccgcagccctggccagcgttccctgcgttcgtcagtgacggatggcggattgaga
gtgtgtgagattacgcgagacggcgcgatgcagacggcgttatggcaccggcggaaaact
cttctcaaaagcgcacttcgctactggattagccggcaacaggaagagcacaggaagcgc
gaggaaaaacaagaacaggagcgagaggaaaaacgacgccagcgtaaagaagtcaaaaaa
agactgctaggagaattagccaatgtgccgcctagaaaaagtgcgcgattgctaacccag
gctccgcgtccaacaatcgcgctaataccacggaagttccgcgaccctccagagcgactt
cctgcagcgcccaaacagttattgacgctatctgcaaagactctttcgcggaaaccgctc
cgccgtactgcacgcctgcaccgctatcatgcttcacaatctgcgcgacgcaggaaacta
gcgcccggagttacaggactgcgcaatctcgggaatacatgctacatgaactccatccta
caggtgctcagccacttgcagaagttccgggagtgtttcctgacgctggacctgtgcgag
acggaggagcttctggctaaaagcaaccaccctcaggtgggggctctgtctgcgggtggc
ggcggcggcggcggcggtgtcccatccagcctgcagtcagcggagcagaaggagccgcgc
tcctcatcccgccagcaggtgtcgctgtgccacgagctgcacacgctcttcagggtgatg
tggtcgggccgctggtcgctggtgtcgcccttcgccatgctgcactccgtctggaacctg
atccctgcttttcgcgggtacgaccagcaggacgcgcaggagttcctgtgcgagctcctg
gataaagtgcagcaggaactggagtcggacgcaccccgcaaacacttcctgatccccatc
acacagcgcaaactctccaaacaggtcctcaaagtgctcaacaccatcttccacggacag
ctgctcagccaggtgacgtgtctgtcctgcaagcggaagtccaacacagtggagccgttc
tgggatttgtctctcgagttcccagagcggtaccaccgcatggagaagcccagcgccgcc
gcctgccagaggagctgctcgctgtccgagatgctggccaagttcacggagaccgaagct
ctggagggctgcatttacgcctgtaacttctgcaacagaaagcggcgtaaatcgtcccac
aagccgctgtcactgtcagaggcctgcaagcagctgctgatctgcagattacctcaggtg
ctgcggctacacctcaaacgcttccggtggtcgggcaggaaccacagggagaagatcggt
gtgcacgtggcgtttgatcaggtgttgaacatccagccgtactgcagctgctcagacgcc
gccgcgagagaggcctacacatacgacctgtctgcggtcgtgatgcatcatgggaagggc
tttggctcagggcactacacagcctactgctacaacactgaaggaggcttctgggttcac
tgtaatgactctgagatgaacgtgtgcagcgtggaggaggtgtgcagcactcaggcctac
atcctcttctacacacagcgctcctcctag

DBGET integrated database retrieval system