KEGG   Danio rerio (zebrafish): 559710Help
Entry
559710            CDS       T01004                                 

Gene name
tapt1b
Definition
(RefSeq) transmembrane anterior posterior transformation protein 1 homolog
Organism
dre  Danio rerio (zebrafish)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF747 DASH_Dad4
Motif
Other DBs
NCBI-GeneID: 559710
NCBI-ProteinID: NP_001116722
ZFIN: ZDB-GENE-030131-4025
Ensembl: ENSDARG00000061143
Vega: OTTDARG00000019426
UniProt: A2BIE7
Position
1
AA seq 567 aa AA seqDB search
MADSVAAGLGDENETENEDKEREKRLFSGVKKMEKQAAASDVTETLGFYERKAKCKDRKT
NVSDLSLVRFISAELTRGYFLEHNEAKYTERRERVYTCLRIPKELEKLMIFGYFLCLDVF
LYVFTLLPLRVLLALVRLLTLPCCGLSGSRILQPAQVCDVLKGFIMVLCYFMMHYVDYSM
MYHLIRGQSVIKLYIIYNMLEVADRLFSSFGQDILDALYWTATEPKERKRAHIGVIPHFF
MAVLYVFLHAILIMVQATTLNVAFNSHNKSLLTIMMSNNFVEIKGSVFKKFEKNNLFQMS
NSDIKERFTNYTLLLIVCLRNMEQFSWNPDHLWVLFPDVCMVIASEIAVDVVKHAFITKF
NDITADVYSEYRASLAFDLVSSRQKNAYTDYSDSVSRRMGFIPLPLALLLIRVVTSSVKI
QGSLSIVCVLLFYLGMITLKVLNSIVLLGKSCMYVKEANMEEKLFQNPPSAAPSRVSSRA
HRTKHTREPPGDPAEEGMSASVTTQPTQQDECPAPQIPTSESDQFLTTPDESEEKSLIQD
DSELKHRAPKKDLLEIDRFTICGNRID
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atggcggactcggtagcggctgggctcggggacgaaaacgagactgaaaatgaggacaag
gagagggagaagcgactctttagtggcgtcaaaaagatggagaaacaagccgctgcttca
gacgtcacagaaacgctgggattttacgagaggaaggcgaaatgcaaagacagaaagacc
aatgtgtcagatctctctctagtgaggtttattagtgctgagttgactagaggatatttt
ctggaacacaatgaggccaaatacactgagcggagagagagagtctacacctgcctgcgt
ataccaaaagaactggagaagctgatgatctttggctatttcctgtgtctggatgtgttt
ctgtacgtgttcactctgctacccctcagagtgctgctggctctggtcagattgctgaca
ctgccctgctgcggcctcagtgggtctcgcatcttgcagcctgctcaggtctgtgatgtt
ctgaagggtttcatcatggttctgtgttatttcatgatgcattatgtggattattccatg
atgtatcacctgatccggggtcagtctgtcataaagctctacatcatctacaacatgctc
gaggtggcagatcgcttgttttcatcttttggtcaagatattttggatgctttgtactgg
acggccaccgaacctaaagagagaaaaagagcacacataggagtcatcccacatttcttc
atggctgttctctacgtctttctacatgccattttgattatggttcaggccacaacacta
aatgtggctttcaattcacataacaaatcactcctcaccatcatgatgtctaataatttt
gttgagatcaaaggaagtgtattcaagaaatttgagaaaaacaatctcttccagatgtcc
aatagcgacattaaagaaaggtttacaaactacacactgttactgattgtatgtctcaga
aacatggagcagttctcctggaatccagatcatctgtgggtgttgtttcctgatgtttgc
atggtaatcgcctcagagattgcagtggacgttgtcaagcatgccttcatcaccaagttt
aatgacatcacagcagatgtctacagtgaatacagagctagtcttgcctttgatctggtc
agcagcaggcagaaaaatgcatacacagactacagtgacagtgtgtccaggaggatgggt
ttcattcctcttcctcttgccctactgttgatccgggtggtgaccagctctgtgaagatc
cagggctctctgtccattgtgtgtgtcctgctcttctatctgggcatgatcacactgaag
gttctgaacagtattgttttgttggggaaatcctgtatgtacgttaaagaggcaaatatg
gaggaaaagctgtttcaaaatcccccttctgcagctccaagcagagtgtccagcagagcc
caccggaccaaacacacacgggaacctccaggtgatccagcagaagagggcatgtctgca
tcagtcaccactcagcccacacaacaggacgagtgtcccgcccctcaaattccaaccagc
gaatcagatcagttcctcacgacacctgatgaatcagaagaaaaaagccttattcaggac
gattccgaacttaaacacagggcacccaaaaaagacttgctggagattgaccgcttcaca
atctgcgggaaccgtattgactga

DBGET integrated database retrieval system