KEGG   Danio rerio (zebrafish): 559732
Entry
559732            CDS       T01004                                 

Gene name
ttc9b
Definition
(RefSeq) tetratricopeptide repeat protein 9B
Organism
dre  Danio rerio (zebrafish)
SSDB
Motif
Pfam: TPR_14 TPR_2 TPR_16 TPR_12 TPR_1 Fis1_TPR_C TPR_6
Other DBs
NCBI-GeneID: 559732
NCBI-ProteinID: NP_001038370
ZFIN: ZDB-GENE-050419-67
Ensembl: ENSDARG00000068421
Vega: OTTDARG00000013345
UniProt: Q1LXX9
Position
18
AA seq 243 aa
MHSTLLQPCKRTQAPVSEQHGFLSEMEAKQHSIKSLKSYPEAGGRSLAAAAGGDGGGGVG
YRVGGAEMDMEAKIQKAIDFKLEGHRCYKEKKFREAIGKYHRALLQLKGIHVVDGTTGSE
VNLLNQAAAKLTEEQRRAVESTEIECYDSLTACLLQSELVNYERVKEYCLKVLGHQQDHF
KAMYRAGIAFYHLGDYECALRYLRDAKCREPTDTNVLRYIQLTEMKMSKSVQQVRESGKE
SLG
NT seq 732 nt   +upstreamnt  +downstreamnt
atgcacagcacgctgctccagccctgcaagagaacacaggcacccgtgtcggagcagcat
ggcttcctgagcgagatggaggcgaagcagcactcgatcaagagcctgaagagctatccg
gaggccgggggccggagtctggcagcggcggcgggtggggacggcggtggcggcgtaggg
tatcgcgtcggcggcgcggagatggacatggaggcgaaaatacagaaggcgattgacttc
aaactggagggtcaccgatgctacaaggagaagaaattccgggaagcgattgggaagtat
cacagggcgcttctgcagctgaaagggatccacgtcgtcgacgggaccacgggatccgag
gtgaatctcctgaatcaagcagcggccaagctgacggaggagcagcggcgagcggtggag
agcaccgagatcgagtgctacgacagcctgacagcatgtttgctgcagtcagagttggtg
aattatgagcgggtgaaggaatattgtttgaaggtcctcggacaccagcaggatcacttt
aaggccatgtatcgagctgggattgccttctatcacctgggggactatgagtgtgccctg
cgttacctacgtgatgccaagtgccgtgaacccacagacacaaacgtgttgcgatacatc
cagctgacggagatgaagatgagtaagagcgttcagcaggtgcgtgagagtgggaaagag
tcattgggttaa

DBGET integrated database retrieval system