KEGG   Danio rerio (zebrafish): 559803
Entry
559803            CDS       T01004                                 

Gene name
smarca1
Definition
(RefSeq) probable global transcription activator SNF2L1
  KO
K11727  SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 1 [EC:3.6.4.-]
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dre03036]
    559803 (smarca1)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     559803 (smarca1)
Chromosome and associated proteins [BR:dre03036]
 Eukaryotic type
  Chromatin remodeling factors
   NuRF complex
    559803 (smarca1)
SSDB
Motif
Pfam: SNF2-rel_dom SLIDE HAND Helicase_C ResIII DEAD DBINO DUF1086 HDA2-3 Myb_DNA-binding
Other DBs
NCBI-GeneID: 559803
NCBI-ProteinID: NP_001093467
ZFIN: ZDB-GENE-070705-296
Ensembl: ENSDARG00000012776
Vega: OTTDARG00000015931
UniProt: A5WUY4
Position
5
AA seq 1036 aa
MSDEELPSTSREAHAEAEEEDPPFLLGPPPKAVVKESLADPEYEEKRKTDRANRFEFLLK
QTELFAHFIQPASQKSPTSPLKVKMGRPRIKQDEKQNLLSVGDNRHRRTEQEEDEELLSE
SRKADNVLVRFEESPSYIKNGTLRDYQIRGLNWMISLYENGINGILADEMGLGKTLQTIA
LLGYLKHYRNIPGPHMVLVPKSTLHNWMNEFKRWVPTLKAVCLIGNKDERAAFIRDVMMP
GEWDVCVTSYEMVIREKSVFKKFNWRYLVIDEAHRIKNEKSKLSEIAREFKTTNRLLLTG
TPLQNNLHELWSLLNFLLPDVFNSASDFDSWFDTNCLGDQKLVERLHAVLRPFLLRRIKA
EVEKSLPPKKEVKIYLGLSKMQREWYTRILMKDIDILNSAGKMDKMRLLNILMQLRKCCN
HPYLFDGAEPGPPYTTDTHLVINSGKMVALDKLLPKVQEQGSRVLIFSQMTRVLDILEDY
CMWRGFEYCRLDGNTPHEAREQAIDAFNAPNSSKFIFMLSTRAGGLGINLATADVVILYD
SDWNPQVDLQAMDRAHRIGQRKPVKVFRLITDNTVEERIVERAEMKLRLDSIVIQQGRLI
DQQNKLGKDEMLQMIRHGATHVFASKDSELTDEDIDTILERGAKKTAEMNERMQNLGESS
LRNFTVDTGATETSLYNFEGEDYREKQKVGVFIFGHLIFVHIAVLKSINLSLIEWIEPPK
RERKANYAVDAYFREALRVSEPRAPKAPRPPKQPNIQDFQFFPPRLFELLEMEILYYRKT
IGYKVPRSPDIPNSAQVQKEEQRKIDEAEPLSPEETEEKEKLLTQGFTNWNKRDFNQFIK
ANEKYGRDDIDNIAREVEGKTPEEVMEYSAVFWERCNELQDIEKIMAQIERGEARIQRRI
SIKKALDVKIARYKAPFHQLRIQYGTNKGKNYTEEEDRFLICMLHKMGFDKEYVYEELRQ
CVRNAPQFRFDWFIKSRTAMELQRRCNTLISLIEKENMEIEEKERAEKKRRTPKGQSAQK
RKAEVSSEKKEKKART
NT seq 3111 nt   +upstreamnt  +downstreamnt
atgtcggacgaagagctaccgtctacttctcgggaggcgcacgcggaggcggaagaggag
gatccgccatttctcctgggtcctcctcctaaagcagtggtgaaggagagcctggctgac
cctgagtatgaggaaaaaagaaaaactgaccgtgcgaacagatttgagttcctgctgaag
cagactgaactgttcgctcatttcattcagcctgccagtcagaagtcccccacgtcacct
ctgaaggtgaaaatggggagaccccgaatcaaacaggatgagaagcagaacctcctttca
gttggagataaccggcatcgtcgaacagagcaggaggaggacgaggagctcctatctgag
agcaggaaggcagataatgttcttgttcgttttgaggagtcaccctcatacattaagaat
ggaacactgagagattaccagatcagaggtctgaattggatgatttctctgtatgagaat
ggcatcaacggcatcctggctgatgagatgggtctgggtaagaccctgcagacaatcgcg
ttgctaggctacctgaagcactacaggaacattccaggccctcacatggtcctagtgccc
aaatctactctgcataactggatgaatgaatttaaacggtgggtgcccaccttgaaggcc
gtctgtctcatcgggaataaagatgaaagagccgcgttcatacgtgatgtgatgatgcct
ggtgaatgggatgtatgcgttacctcatatgagatggtgattcgggagaaatctgtgttt
aagaagtttaactggcgctacctggttatcgacgaggctcatcgcatcaagaatgagaaa
tcaaagttgtcagagatcgcgcgtgagtttaagacgaccaatcgtctgttgttgactggg
accccactgcaaaataatctacacgagctctggtcgcttttgaacttcctgctgcctgat
gtgttcaactctgccagtgattttgattcatggtttgacacaaactgcctgggtgaccag
aagctggttgaaagacttcatgctgttctgcgtccattcctgctgcgccgtatcaaagca
gaggtggagaagagtcttcctcccaagaaagaggtgaagatttacctggggctcagtaaa
atgcaaagggaatggtacacacgtattctgatgaaggatattgacatcctgaactctgct
ggaaagatggataagatgcgacttctgaatattctgatgcagctgcgaaaatgctgcaac
catccatacctgtttgacggggcagagcctggtcctccatacaccacggacacacactta
gtcatcaacagcggcaagatggtcgctctggataagcttctgcctaaagtgcaagagcaa
ggatccagagtgctaatattcagccagatgacgcgtgtgttagatattctggaagactat
tgcatgtggagaggcttcgagtactgcagattggatggcaatacacctcatgaggccaga
gagcaagccatagatgcttttaacgccccgaacagcagtaaatttatcttcatgctgagc
acacgggcaggtgggctggggattaatttggctacagctgacgtggtgattctctacgac
tcagactggaacccacaggtggacttgcaggccatggaccgtgctcaccgaattggacag
aggaaaccagttaaagtgttcaggttgatcacagacaacacagtggaagagagaattgtg
gagagagccgagatgaaactacggctggactccatagtcattcagcaaggacggctgatt
gatcagcagaacaaacttgggaaggatgaaatgctacagatgatccgacatggagcaaca
cacgtttttgcctctaaagatagtgaactaacggatgaagatatcgacaccattctggaa
agaggagccaagaagacggctgagatgaacgagcgcatgcagaatctcggcgagagctca
ctaaggaacttcaccgtggacacaggagccacagagaccagcctttacaactttgaagga
gaggattacagagagaaacagaaagttggtgttttcatatttggtcacttaatatttgtg
catattgcagttcttaagtccattaaccttagtttgatcgaatggattgagcctcctaag
agagaaaggaaggccaattatgctgtagatgcttacttcagagaagcgctgcgagtcagc
gaaccaagagccccgaaggctcctcggcctccaaaacaacccaacatccaggactttcaa
ttctttccaccacgtctctttgagctgcttgagatggagattctttactacaggaaaacc
attggatacaaagttccacgtagtccagatattccaaattcagcacaggtccagaaggag
gaacaaagaaagatcgacgaggcagagcccctttctcctgaagaaacagaggaaaaagag
aaactactcacacaaggattcacaaactggaacaagcgtgatttcaatcagtttattaaa
gctaatgagaagtacggtcgtgatgacatcgacaacatcgccagagaggtggagggcaag
acccctgaagaagtcatggaatactcagctgtgttttgggagcgctgtaacgagctgcag
gatattgagaagattatggctcagatagagcgcggagaagctcgcatccagagacgcatc
agcatcaagaaagcgctggacgtcaagatagcgcgctacaaggccccattccatcagctc
cgcatccagtatggcacaaataaaggaaaaaactacacagaggaggaggacaggtttctg
atttgcatgttgcataagatgggctttgataaagaatatgtctatgaagaacttcgacag
tgtgtacgaaatgcgcctcagttcagattcgattggttcatcaagtccagaactgccatg
gagctgcagcgccgttgtaacacactcatttctctcattgagaaagagaacatggagata
gaggagaaagagcgagctgagaaaaagagaagaacacccaaaggacaatcagctcaaaag
cgtaaagcagaagtgtcatctgagaaaaaggagaagaaagctcgtacctga

DBGET integrated database retrieval system