KEGG   Danio rerio (zebrafish): 560411Help
Entry
560411            CDS       T01004                                 

Gene name
elmsan1b
Definition
(RefSeq) ELM2 and SANT domain-containing protein 1
Organism
dre  Danio rerio (zebrafish)
SSDB OrthologParalogGFIT
Motif
Pfam: ELM2 Myb_DNA-binding zf-C2H2_4 zf-C2H2 FapA
Motif
Other DBs
NCBI-GeneID: 560411
NCBI-ProteinID: XP_009291493
ZFIN: ZDB-GENE-131121-13
Ensembl: ENSDARG00000053864
Vega: OTTDARG00000038824
UniProt: E7FFR7
Position
17
AA seq 1095 aa AA seqDB search
MKVMSLQPQPKPNAKRTGKRITFFNDQGVAMKEASQHTGPYYGVGVPPSGPGHNDSGGVE
SFNPEASRMYHNSVIFSPEKGDQSRGHYQQTMPLKWTHQDPSLQPQPRPNSWSQGTTAWQ
QNFGPYLTPQAAFAKQMHEGISVQQQQQQSEPSAIRTTEKQANMTGETYRDATKPVRGMG
EWDQQQAFQQTQKPGMLNPQQHGQSTTGNSVLQPFQLAFGQPKQNLVAGYYQVVQGSRTL
PNLNYSSQTNSQHQLQQLQQQEQQKLMLQQRQQQIEQQIRQQQQQQQQVLQRQKQQQQIP
QSLEQAHQLKQTPQQHMQQIQAQLVQQQQKSEQSHQNQHALGVYSDGQQPHAPLLNQHHP
SLSGQSQETTDPSSTQAQESVPQPPAAVSQQAIETQQPGPRRSRRLSKEGGGPASDNPFV
IPSDLHAQGSQNGASETSMVQDIRAAPTGVIQSTRRKRRVSQEANLETLAQKASERESLP
SRNVKQEPHRPWSPPVVPTGPGRGAAEVDQVSAKRPRDDSLMPLVIPVSVPVRQTDSSSP
DHEQASLSVSWPLRPSDMSCSNYQPSVIVTRRRSLRNSPSESTGQNGGAESGSEADSKSA
KAKRRPRPEPLFIPPPKLGTFIAPPAYSSITPFQSHLRSPVRLVDNPLNMPPYTPPPILS
PVREGSGLYFSTFLSAAAAAAAAANNQVLPPPATPKSATRSLLRSNSSDITPPVLSAISE
ATPVSIEPRINIGVRYQAEVPELRERSAALHDLHKAELVWAPLPDLEASAQQQQKVNDLM
HLACSSALFGGGTNQELAMHCLYECKGDIMGTLTHLLLKKNIFSKSHPLADYHYSGSDSW
TPEERRLFNKGIATYKKDFFMVQKLVSSKTVAQCVEFYYTYKKQVKIGRNGTLVYGETEP
LETKPTTEEEVDNKSSQKLESRKEDEESRKWEGSCDRKQEDSPGRVTQSLQATENAAAVL
VLSQENSTRHPSTLGVSHPPHPPQPPSKSRSDTAARKTGPSNTGKGQTNQEGEFPCKKCG
RIFYKVKSRSAHMKSHAEAEKKAAALRQREAEQRAAAALLAAQQNGAMADQGRGRRASSD
DSSDEDEDADDEDWR
NT seq 3288 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcatgagtttgcaacctcaaccgaaaccaaacgcaaagagaacaggcaaacgt
atcactttctttaacgatcagggtgtggcaatgaaagaagcctctcagcatacggggccc
tactatggcgtcggggtcccaccttcagggccaggccataatgacagcggaggtgtggaa
agcttcaatccagaagcatcacgcatgtaccataattcagttattttcagtccagagaag
ggtgatcaaagccgtgggcattatcaacagacaatgcccttgaagtggacacatcaagac
ccatctctgcagccccaaccaagaccaaacagttggtcacagggtacgaccgcttggcaa
cagaactttggtccttacctgacacctcaggctgcttttgcaaaacaaatgcacgaaggt
atatcagttcaacaacagcagcagcaatctgagccatcagctattaggacaaccgaaaag
caggctaacatgactggagagacctacagggatgcaactaaacctgtccggggcatgggg
gaatgggatcagcagcaagcctttcagcagacacaaaagcctggaatgttaaatccacag
cagcacggacagtccaccactgggaattctgtgctgcaaccctttcagttagcttttgga
cagcccaagcagaacctagtagcaggttactatcaggtagtccagggcagtcggacctta
ccaaatttgaactatagttcacagacaaattctcaacatcaacttcagcaactacagcaa
caggagcaacaaaagttaatgctccaacagcgacagcaacagatagagcagcagatacga
caacagcagcagcagcaacaacaggtacttcagcgtcaaaaacagcagcaacaaatacca
cagtcactggagcaagcacatcaattaaaacagactccacaacagcatatgcaacagatt
caggcacaactggtgcagcagcaacaaaaatcggagcaatctcatcaaaaccaacatgca
ttgggagtttactctgatggccagcagccacatgctcctttgcttaatcagcatcacccc
tcgttatcaggacaatcccaggagactacagatccttcatcaacccaggcacaggaatcg
gttccccagcctcctgcagctgtttcacagcaagccatcgaaacccaacagcctggacca
cggagatcccgtcggctttcaaaagagggtggaggacctgcctcagacaacccatttgtt
ataccgtctgatcttcatgctcagggttctcagaacggggcttctgagacctctatggtg
caagacattcgggccgctccaactggtgtaatccagagcactcggcggaagaggagagtg
tcacaagaggccaacctagaaaccctggctcagaaggcttcagaaagagaatctcttccc
tcacgtaatgtcaagcaagagccacacaggccttggagtccgcctgttgtcccgacaggt
cctggtcgaggggcagctgaggtggatcaggtgagtgccaagcggcccagagacgacagc
ctcatgccattggtcattccagtctctgtaccagtgaggcagactgactcctcatccccg
gatcatgagcaggcttccctctccgttagctggcctttgcggccttctgacatgagctgc
tccaattaccagccctctgtgattgttacacgacggcgctcgctgaggaactccccatct
gagagcacgggccagaatggcggagcagagagcgggagtgaagctgacagcaaatcagcc
aaagccaaacgacgtcctcgtccagaaccgctctttatccccccacccaaacttggcact
ttcatcgccccaccggcctactccagcatcacacccttccagagtcacctacgatctcct
gtccgattggtggacaaccccctcaacatgccgccttacactcctccgcccatcctcagc
ccggttcgagagggttcgggtctttacttctccacgttcttgtcggctgcggctgctgca
gctgctgctgctaataatcaggtgctgcccccgcctgccactcccaaatcagccacccgc
agccttctgcgctcaaacagcagcgatattacccctccagttctctcagctataagtgaa
gctacacctgtcagcattgagcctcggataaacattggagtgcggtatcaagcggaggtc
cccgagctgagagagcgatcggcagcgctgcacgacctacacaaggctgaactggtgtgg
gcgccactgcctgacctagaggccagtgctcagcaacagcaaaaagtgaatgacctcatg
cacctggcctgttcaagtgcgttattcggaggagggaccaatcaggagctggccatgcac
tgcctgtatgagtgcaagggtgacatcatgggaaccctcacacatctgctattaaaaaaa
aacatcttttccaaatcgcaccctctggctgactaccactactctggctctgacagctgg
acgccagaagagcgacggctctttaacaaaggcatcgctacttacaagaaggacttcttc
atggtccagaaactggtgagctccaagactgtagcacagtgtgtggagttttactacaca
tataagaagcaggtgaagatcggcaggaacggcacgctcgtatacggagaaacagagccg
ctggagactaaacccacaacagaggaggaagtggacaacaaaagttcacagaaactcgaa
tcacggaaagaagatgaggagagcaggaagtgggaagggtcatgtgacaggaagcaagaa
gacagccccggcagggtgacacaatctctacaggccaccgaaaatgctgctgccgtcttg
gtcttgagtcaggagaacagcaccagacatccgtccacattgggggtcagtcatcctcct
catccacctcaaccaccatccaaatctcgctccgacactgctgccaggaaaactgggccc
agcaacacaggaaagggacaaaccaaccaagagggcgaattcccctgcaagaagtgtggc
aggatcttctataaggtgaagagccgcagtgcccacatgaagagtcacgccgaggcggag
aagaaagcggcggcgctccggcagagagaggccgagcagcgggcagcagccgccttgtta
gcggcccagcagaacggggcgatggcagatcagggcagagggaggagagcgagcagcgac
gactcttctgatgaagacgaggatgcagatgatgaagactggcgctag

DBGET integrated database retrieval system