KEGG   Danio rerio (zebrafish): 560486
Entry
560486            CDS       T01004                                 

Gene name
xdh
Definition
(RefSeq) xanthine dehydrogenase/oxidase
  KO
K00106  xanthine dehydrogenase/oxidase [EC:1.17.1.4 1.17.3.2]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00230  Purine metabolism
dre00232  Caffeine metabolism
dre00983  Drug metabolism - other enzymes
dre01100  Metabolic pathways
dre04146  Peroxisome
Module
dre_M00546  Purine degradation, xanthine => urea
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    560486 (xdh)
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    560486 (xdh)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    560486 (xdh)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    560486 (xdh)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dre04147]
    560486 (xdh)
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     560486 (xdh)
   1.17.3  With oxygen as acceptor
    1.17.3.2  xanthine oxidase
     560486 (xdh)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   560486 (xdh)
SSDB
Motif
Pfam: Ald_Xan_dh_C2 FAD_binding_5 Ald_Xan_dh_C CO_deh_flav_C Fer2_2 Fer2
Other DBs
NCBI-GeneID: 560486
NCBI-ProteinID: XP_688983
ZFIN: ZDB-GENE-070719-9
Ensembl: ENSDARG00000055240
Vega: OTTDARG00000035080
UniProt: E7F022
Position
17
AA seq 1351 aa
MSISEDKIKNKLQSPGDDLVFFVNGKKITEKNADPEITLLTYLRRSLGLTGTKLGCAEGG
CGACTVMVSKYHPNQNRIIHYAINACLAPLCSLHHCAVTTVEGIGSVASKLHPVQERIAK
AHGSQCGFCTPGIVMSMYALLRNNPQPTMHDIQEAFQGNLCRCTGYRPILEGYRTFTKDG
GCCGGKSQTNGCCMTNGNTQEHENSAHPVQHLYDQSEFMPLDPTQEIIFPPELVSLSKQT
QREMRFVGERVLWIQPCSLKELLELKATYPNAKLVVGNTEVGIEMKFKNLLYPVILAPAY
IPELNIIQHTQDGIEVGASVTLTVLGDVLQSAVKKLPAYQTEVFKAVLEQLRWFAGQQIR
NVAAVGGNIMTASPISDLNPVFMAAGCKLTVMSKGEKRVLEMDDKFFTGYRKTALKPEEI
LLSIEIPYTKKGQYFSAFKQSPRKEDDISIVTCGMNVYFKEQSNTVQSIRISYGGMAPVT
VLATATCNKLLNRQWNEDLLEEACSSLAEEMSLSPSAPGGMVTYRRTLTISLFYKFFLTV
QHKLAVSLQMEGVTVEDIQPEFSTATELFQVDTPSSVQLYQEVPPGQNEDDVVGHPIIHL
SALKQATGEAVYCDDMPCYENELHLALVTSTKAHALIKSIDTSSAMSVPGVVAFISAKDI
PGSNMTGPVVYDETVFADDKVTCVGHIVGAIVADTQAHAQRAAKVVKISYEELKPVIVTI
QDAINNKSFFEPVRTIEKGDVAQGFKDSDHILHGEMHIGGQEQFYLETNCTLAVPRGEDG
EMELFVSTQSASKTQALVAKALGVPANRVVCRVKRMGGGFGGKESRSTILSTVVAVAAQK
VKCPVRCMLDRDEDMLVTGGRHPFFGQYKVGFMKNGRVMALEVTLYSNAGNSLDLSLSIL
ERALFHMDNSYNIPNICGTGYMCKTNLPSNSAFRGFGGPQGMMIAESWMSDVALSCGLPA
EEVRRMNMYNEGDLTHFNQRLDQFTIARCWEECMQLSDFNKRKDAVEKYNRQHRWTKRGL
SIIPTKFGISFTAVFLNQAGALVHVYSDGSVLLTHGGTEMGQGLHTKMVQVASKTLEIPC
TKIHITETSTSTVPNTSPTAASASSDLNGMAVYNACQTILQRLQPFKEKNPKGCWEDWVT
AAYFDRVNLSANGFYKTPDLGYDFDTNSGRPFNYFSYGVAVSEVEIDCLTGSHKNLHTSI
VMDVGKSLNPALDIGQVEGGFMQGLGLFTLEELRYSPDGYLYTRGPGMYKIPAFGDIPSE
LKVSLLRDAPNDKAIFSSKAVGEPPLFLAASVFYAIKDAITAARAESGLTGPFRLDSPAT
PERIRNACEDKFTKLCPPADPGTFIPWAVQV
NT seq 4056 nt   +upstreamnt  +downstreamnt
atgtccatcagcgaggataagattaaaaacaaacttcagtctccaggggatgaccttgtc
ttcttcgttaatggaaaaaagatcactgagaagaatgcagaccctgaaataacactcttg
acttatcttagaagaagcttgggtctgacaggaaccaaactgggatgtgctgaaggaggt
tgtggagcctgcactgtaatggtctccaaatatcatccaaatcaaaaccggattattcac
tatgccattaatgcctgtctggctcctctgtgctctttgcatcactgtgcggtaacaacc
gtggagggcatcggcagcgtggcaagcaaactccatcccgtacaggagcgaattgcaaag
gctcacggctcacagtgtgggttctgtactccaggaattgtgatgtctatgtacgctctt
ttaagaaacaacccacaacccaccatgcatgacattcaggaggcttttcaaggaaactta
tgccgctgtactggttacagacctattctagaaggctacaggacattcacaaaggatggg
ggatgttgtggtgggaaaagtcagactaatggctgctgtatgactaatggaaacacacaa
gagcatgaaaattcagcacatccagttcagcacttgtatgaccaatcagagtttatgcca
ctggacccgacacaagagattatttttccacctgagcttgtgagtctgagtaaacagacc
caaagagagatgaggttcgttggggagcgagtgctttggattcaaccctgctccctcaag
gagcttctggagctgaaggccacatatccaaatgccaaactagtcgttgggaacacagaa
gttggcattgagatgaaattcaaaaaccttctttatcctgtgattctggcaccagcttac
attccagaactgaatatcatccaacacactcaggatggtattgaggttggcgcatcagtg
acgttgactgtgctgggggatgtcctgcagtcagctgtgaagaagttgcccgcttatcaa
actgaggtttttaaggctgttctagagcagctgcgctggtttgcaggacagcagatccga
aatgttgcagctgttggtggaaatattatgacggcaagtcccatttcagacctcaaccct
gtgtttatggcagctggctgcaagctaacagtgatgtccaaaggggagaaacgagttctt
gaaatggatgacaagttcttcactggttatcgtaagactgctttgaagccagaggagatt
cttttgtccattgagattccatacacaaaaaagggccagtacttctcagccttcaagcaa
tcccctcgcaaagaggatgatatctctattgtcacgtgtgggatgaatgtatatttcaag
gagcaatccaatacagtacagagtatccgaataagctatggaggaatggcccctgtcact
gttcttgctacggccacatgcaacaagttgcttaacaggcaatggaatgaagatcttctt
gaggaagcctgcagctcattggctgaggagatgagtctatctccctcagctccgggtggg
atggtgacatacaggcgcacattgactatcagcctcttctacaaattcttcctcactgtc
cagcacaaactggctgtgagcctgcagatggagggtgttaccgttgaagacatccaacct
gagttttccactgctactgaactcttccaagtggacacaccatccagtgtacagctttat
caggaagttcctccaggtcaaaatgaggatgatgttgtggggcaccctatcatacacctc
tctgctcttaaacaggccacaggagaagcggtatactgtgacgacatgccttgctatgaa
aatgagcttcatttggctttagtcaccagcactaaagctcatgccctcataaaatccatt
gacacctccagtgcgatgtcagttcctggagtggttgcatttatttctgccaaagacatc
cctggaagtaatatgactggacctgttgtctatgatgagacagtttttgcagatgataag
gtcacatgcgttggacatatagtgggggccattgtggcagacactcaggctcatgcgcag
agagcagccaaagtggtgaagatcagctatgaggaactgaagcctgtcattgtgaccatt
caggatgctattaacaacaagtcattcttcgagccagttagaactatagaaaaaggagat
gttgcacaaggatttaaagactctgatcacatcctgcacggtgagatgcacattggaggg
caggaacagttttatctggagactaactgcacgctggctgtccctcgtggagaggatgga
gaaatggagctgtttgtgtccacacagtcggcctccaagacacaagctctggtggctaaa
gctttaggtgttcctgctaatcgggtggtgtgtcgtgtgaagagaatgggtggaggattt
ggagggaaagagagtcggagcaccattctatccactgtggttgctgttgccgcacaaaag
gttaagtgcccggttcgctgcatgttagatcgtgatgaggacatgctggtcacaggtggc
cgccatcctttctttggacagtacaaggtgggttttatgaagaatggaagagtgatggca
cttgaggtgacgctctacagcaatgcaggcaattcactggacctgtcattgtcaatcctg
gagagggcgctgttccacatggataactcctacaacattcctaacatttgtggcacaggc
tacatgtgtaaaaccaacctgccgtctaattctgcattcagaggctttggtgggccgcag
ggcatgatgatcgcagagagctggatgagtgatgtggccttgagctgcggtctgcctgcc
gaagaggtgaggaggatgaacatgtataatgagggagatctcacacactttaatcaacgt
ctggaccagttcaccatcgctcgctgctgggaggagtgcatgcagctctcagacttcaac
aagcgcaaggatgctgtggagaaatacaacaggcagcaccgctggaccaagagagggctg
tccatcattcccaccaaatttggcatcagctttactgctgttttcctcaaccaggcaggg
gcattggtacatgtgtactcagatgggtctgtactgctaactcatggtggaacagaaatg
gggcaaggtctgcacacaaaaatggtccaggtggctagtaaaacacttgaaatcccctgc
acaaagattcacattacagagaccagcactagcacagttcccaacaccagccctacggcc
gcatccgcctcctctgacctcaacgggatggccgtctataatgcttgccagactatacta
cagagacttcagccttttaaagaaaagaaccccaaaggctgctgggaagactgggtcaca
gcagcctactttgacagagtaaatctgtctgccaatggattctacaagactccagatctt
ggttatgattttgacaccaactcaggaaggccttttaactacttcagttatggtgtggcc
gtctcagaagtggagatagactgtctaactggcagtcataagaatcttcatacgtccata
gtgatggatgtgggcaagagtttaaatccagcactggacattggacaggtagaaggtggg
ttcatgcaaggcttaggtctgttcacgctagaggaacttcgctactctcctgacggttac
ctatatactcgtggacctggcatgtataagattcctgcttttggggatattcccagtgaa
ttaaaggtttcgctgctcagagatgctccaaatgacaaagccatcttttcttcaaaggct
gtgggtgaacctcctctctttctggcggcctcagtgttttatgccattaaagatgccatc
acagctgccagggctgagtctggactgaccggacccttcagattggacagccctgccact
cctgaacgcatacgaaatgcctgtgaagataagtttaccaaattgtgtcctcctgcggat
cctggcacctttattccatgggcagtgcaggtctga

DBGET integrated database retrieval system