KEGG   Danio rerio (zebrafish): 560881Help
Entry
560881            CDS       T01004                                 

Gene name
mtm1
Definition
(RefSeq) myotubularin isoform 1
  KO
K01108  myotubularin [EC:3.1.3.64 3.1.3.95]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00562  Inositol phosphate metabolism
dre01100  Metabolic pathways
dre04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    560881 (mtm1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    560881 (mtm1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dre01009]
    560881 (mtm1)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     560881 (mtm1)
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     560881 (mtm1)
Protein phosphatases and associated proteins [BR:dre01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    560881 (mtm1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related GRAM 3-PAP Y_phosphatase DSPc Cor1 Vps36_ESCRT-II
Motif
Other DBs
NCBI-GeneID: 560881
NCBI-ProteinID: NP_001032773
ZFIN: ZDB-GENE-051113-128
Ensembl: ENSDARG00000037560
Vega: OTTDARG00000035424
UniProt: Q32PM3
Position
7
AA seq 639 aa AA seqDB search
MTFRRGSGFHLRLLRENSRLNAALESCRKVNAVMASAPIAPYNSSPLGNSSSQNASRESL
KMEPLADVTLLPGEERVIDKDIIYICPYNAAVKGKVFITNYRLYFKNTDSETPVTLNIPL
GVISRVEKMGGASSRGENSYGLEITCKDMRNLRFALKQEGHSRRDIFEIIFKYAFPLSHG
MQLFAFLSQEKYEENGWNVYEALEEYRRQGLPNNEWRVTFINKNYELCDTYPTILVVPYK
ATEDDLRKVATFRSRCRIPVMSWFHKENHAVITRCSQPLVGMSGKRNKDDERYLDLIREA
NGTTKLTIYDARPNVNAVANKATGGGYEGDDAYQNAELVFLDIHNIHVMRESLKKLKDIV
YPNVEESHWLSSLESTHWLEHIKLVLSGAIQVADKVSSGSSVMVHCSDGWDRTAQLTSLS
MLMLDSYYRTLRGFQVLMEKEWISFGHKFASRIGHGDKNHADQDRSPIFLQFIDCVWQMT
KQFPTAFEFNERLLVVILDHLYSCRFGTFLYNCESVRDSNNVRTKTVSLWSYINSDTSLY
INPFYTPESSRVLYPVASMRHLELWVTYYIRWNPRIQHQQQSPVEQRYKELLALRDQYLK
KLEELQLSDSAPSSTHLTNSSTPNAATPNQHITHLQTPF
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgacttttcgacgagggtctggcttccatttacgcctgcttagagaaaactccaggcta
aatgcggcacttgagagctgtcgtaaagtaaacgcagtgatggcctcggctcctatagca
ccttataactccagtcctcttgggaacagctccagccaaaacgcgtccagagagagcctg
aagatggagccgctggcagatgttacgctgctgccgggagaagagagagtgatcgataaa
gatatcatctacatctgcccctataatgctgcagtcaaaggaaaggtgttcatcaccaac
tacagactctacttcaaaaacactgactcagagacaccagttaccctgaacatcccctta
ggtgtcataagccgtgtagaaaagatgggcggagcctccagtcgaggagaaaactcttac
gggcttgaaatcacctgcaaggacatgaggaacctgcgatttgctctgaagcaagaaggc
cacagtcgaagggacatctttgagattattttcaaatacgctttcccactttctcacgga
atgcaactctttgcctttttaagtcaggagaagtatgaggagaatggctggaacgtgtat
gaggccttggaagagtataggaggcagggtctacccaataatgagtggagggtcactttc
atcaataagaactacgagctctgtgacacctatcccacaattcttgttgttccctacaag
gccacagaagatgatctacgaaaagtggctacatttcgatcgcgctgccgcattccggtg
atgtcgtggttccataaggagaaccatgctgtgatcacacggtgtagtcagcctttggtg
ggtatgagtggcaagcgcaacaaagatgatgagcgttatttggacctaatccgggaggcc
aatggtactaccaaactcaccatctatgacgccaggcccaacgtcaatgctgtggcaaac
aaggccacgggcggaggttatgagggtgatgatgcttatcagaacgcagaactggtcttt
ctggacattcataatattcatgtcatgagggagtcactgaagaagctaaaggacattgtt
taccccaatgtggaggaatctcattggctctccagcctggagtccacgcattggctagag
catatcaagctggtgctgtcgggggccattcaggtggctgataaggtgtcttctgggagt
tctgtgatggttcactgcagtgatggctgggatcgcactgctcagctcacatctctgtcc
atgctgatgctggactcctactataggactctcaggggcttccaggtcctgatggagaag
gagtggatcagcttcggacacaagtttgcctcaagaattggccatggggacaaaaaccat
gcggatcaggacaggtcacctatctttttgcaatttattgactgcgtgtggcaaatgact
aaacagttcccaacagcgtttgagtttaacgaacgtctcctggtggtcattctggatcat
ctgtacagctgccgcttcggcactttcctctacaactgtgagagtgttcgtgacagcaat
aatgttcggacaaagactgtgtctctgtggtcttacattaatagtgacacgtctttgtat
ataaaccccttctacacgccggagtccagtcgggtgctgtaccctgtagccagcatgcgc
cacctagagctgtgggtcacttactacatcaggtggaacccgcgcatacaacaccagcaa
cagagtccagtggagcagcgctacaaagagcttctggcattaagggatcagtacctgaag
aaactagaggagctgcagctctcagactccgccccttcctccacccacttgacaaacagc
tccacccccaatgctgccacgcccaatcagcacatcacacatttgcagacaccattttga

DBGET integrated database retrieval system