KEGG   Danio rerio (zebrafish): 560955
Entry
560955            CDS       T01004                                 
Symbol
npffr2a
Name
(RefSeq) neuropeptide FF receptor 2a
  KO
K08375  neuropeptide FF receptor 2
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    560955 (npffr2a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:dre04030]
    560955 (npffr2a)
G protein-coupled receptors [BR:dre04030]
 Rhodopsin family
  Peptide
   Neuropeptide FF
    560955 (npffr2a)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Other DBs
NCBI-GeneID: 560955
NCBI-ProteinID: NP_001098579
ZFIN: ZDB-GENE-060526-183
Ensembl: ENSDARG00000033635
UniProt: A2AV71
Position
5:complement(45612068..45651311)
AA seq 422 aa
MNESLDLNITLVDDGNWTFINGSSEFFLPLNNITYVGYYLHQPSVAAVFIVSYLLIFLVC
MIGNGVVCFIVLRSKNMRTVTNLFILNLAISDLLVGIFCMPTTLLDNIITGWPFGSMVCK
MSGMVQGISVSASVFTLVAIAVDRFRCIVYPFKQKLTISTATFIIVIIWVLAVSIMCPSG
VMLQVTKEQNIRVFRGNNRSSPFYWCRENWPNQEMRKIYTTVLFANIYLAPLSLIVIMYA
RIGITLFKTAMPAGGKHGHDNRHSVSKKKQRVIKMLLIVALLFILSWLPLWTLMMLTDYV
KLTEHQYRVINIYIYPFAHWLAFFNSSVNPIIYGFFNENFRRGFQAIFKFGLCPVGGQHR
TYSHRVQGNSVQPVNLQPSTEPISLNSLENNSSRRMNHINEQDLVMEDLEKVSEYSMEGA
SL
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgaacgagtctctggacctgaacattacccttgtggatgatggtaactggactttcatc
aatggctcgagtgaattctttttacctttgaacaacattacatatgttggatattacctg
caccagccatcagtagcagctgtcttcatagtgtcctacctcctcatattcctggtctgc
atgattggaaatggagtggtttgcttcatcgtgttacggagcaaaaatatgcgcactgtc
accaacctattcatcctcaacctcgccatcagcgatcttcttgttgggattttctgcatg
cccacaacgcttcttgacaacattattacaggttggccattcggaagcatggtatgcaaa
atgagcggcatggtgcagggcatttcagtctcagcctctgttttcaccttggttgccata
gcggttgacagatttcgatgtattgtgtatcccttcaagcaaaaactgacaatatcaaca
gccaccttcattattgtgatcatctgggtgctggcggtgtccatcatgtgcccttctggt
gtcatgctccaggtgactaaagaacaaaacatccgtgtgtttcggggaaataatcgatca
agccctttctactggtgtagagaaaactggcccaaccaggaaatgaggaagatctacact
accgtcctgttcgccaacatttacctcgcccctctgtccctcatagtgatcatgtatgca
aggattggtatcactctgtttaaaacggctatgccggcagggggcaaacatggccatgat
aatcgccattctgtgtcaaagaagaaacaaagagtgatcaaaatgctcctcatcgtggcc
ttgctcttcatcctgtcctggttacctctgtggacgctgatgatgctaacagactatgtt
aaacttaccgaacatcagtacagggtcattaacatctacatatatccatttgctcactgg
ctagcttttttcaacagcagcgtcaacccaatcatttatgggtttttcaatgagaacttc
cgccgtggatttcaggccatctttaagtttggcctgtgtcctgtcggcggtcaacatcgg
acttattctcacagggtacaaggcaattctgtgcagccggtgaatctgcaaccctccacg
gagccgatctctctaaatagcctggagaacaacagctcgaggaggatgaatcacattaat
gagcaggacttggtgatggaagatttagagaaagtgtctgaatacagtatggaaggagct
tctctttaa

DBGET integrated database retrieval system