KEGG   Danio rerio (zebrafish): 561018
Entry
561018            CDS       T01004                                 

Gene name
cmasa
Definition
(RefSeq) N-acylneuraminate cytidylyltransferase A
  KO
K21749  N-acylneuraminate/3-deoxy-D-glycero-D-galacto-nononate cytidylyltransferase [EC:2.7.7.43 2.7.7.92]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00520  Amino sugar and nucleotide sugar metabolism
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    561018 (cmasa)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.43  N-acylneuraminate cytidylyltransferase
     561018 (cmasa)
    2.7.7.92  3-deoxy-D-glycero-D-galacto-nonulopyranosonate cytidylyltransferase
     561018 (cmasa)
SSDB
Motif
Pfam: CTP_transf_3 NTP_transf_3 Hydrolase_3
Other DBs
NCBI-GeneID: 561018
NCBI-ProteinID: NP_001035342
ZFIN: ZDB-GENE-050420-277
Ensembl: ENSDARG00000057334
Vega: OTTDARG00000007821
UniProt: Q0E671
Position
4
AA seq 430 aa
MDAVNENGKRAMKDDSHGNSTSPKRRKSRHISALILARGGSKGIPLKNIKMLAGVPLIGW
VIRAAVDSNVFNSVWVSTDHEEIAKVALAWGAKVHKRSPEVSQDSSSSLDTIREFSRQHR
EVDVICNIQATSPCLHPKHLTEAVELITKQGYDSVFSVVRRHNFRWKEVEKGGDCSTEPM
NLNPACRPRRQDWSGELCENGSFYFAKKELIEQGLLQGGKKTYYEMKPEYSVDIDVDIDW
PVAEQRVLRFGYFGKDKPEVVRLLLCNVSGCLTDGQIYTSASGEEMVSINIRDQIGISML
KKEGVKVILLETYPIAKALAVRLSERMGCPLLHHMDDKLKEVERIMVEEKLEWKEVAYLG
NDEADVKCLELAGLSGVPVDAPTVALNHTKYTCHNAAGHGAVREFAEHILLLKKKAKSQM
EQDRICRDAF
NT seq 1293 nt   +upstreamnt  +downstreamnt
atggacgcagtaaatgaaaacggtaaacgcgctatgaaggacgacagtcatgggaacagt
accagcccaaaacgaagaaaatccagacacatctctgctcttattctggcccgtggaggg
agtaaaggaatccccctgaagaacattaagatgcttgcaggggttcccctgatcggatgg
gtgatcagagcggctgtggactccaatgtctttaacagtgtttgggtgtctactgatcac
gaagagatcgccaaagtggccttggcttggggtgcaaaggtgcacaagaggagcccagaa
gtgtcccaggactcctccagctcactggacaccattcgggagttcagcagacagcaccga
gaggtggatgttatctgtaacatccaggccacgtctccgtgtttgcacccaaaacatctc
acagaggctgtggaactcataacgaaacaagggtacgattcagtcttctctgtggtccgc
aggcacaattttcgatggaaagaggttgagaaaggaggagattgcagcactgaaccgatg
aacctgaacccagcttgcaggccgcggcgtcaggactggagtggagaactgtgtgaaaat
ggctctttttacttcgcaaagaaagagctcatagaacaagggcttcttcagggtggaaag
aaaacatactatgaaatgaagcctgagtacagcgtggatattgatgtggacatagactgg
cctgttgctgagcaaagagttctgaggtttggatactttgggaaggacaaacctgaagtt
gtgaggctcttgctgtgtaacgtgtctggatgtctgacagacggtcagatctacacctca
gcgagtggagaggagatggtgtccatcaacatcagagaccagatcggcatcagcatgctt
aagaaagaaggagtgaaggtgattttacttgaaacataccccatagcaaaagcattagct
gtcagactgtctgagaggatgggctgtcctctcctgcaccacatggacgacaaactgaag
gaggtggagagaatcatggtggaggaaaagctggagtggaaagaggtggcgtatttaggg
aatgatgaagcagatgtgaagtgtctggaattggcagggttgagtggagtacctgtggac
gccccgacggtggcgctcaaccacactaaatatacctgccacaacgcagcgggtcacggg
gcagtgcgcgagtttgccgaacacatccttctcctgaagaagaaggccaagtctcagatg
gagcaggacagaatctgcagagatgcattttaa

DBGET integrated database retrieval system