KEGG   Danio rerio (zebrafish): 561353Help
Entry
561353            CDS       T01004                                 

Gene name
efr3bb
Definition
(RefSeq) protein EFR3 homolog B isoform X1
  KO
K21842  protein EFR3
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dre04131]
    561353 (efr3bb)
Membrane trafficking [BR:dre04131]
 Endocytosis
  Others
   EFR3-PI4KIII alpha complex and associated proteins
    561353 (efr3bb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 561353
NCBI-ProteinID: XP_005170258
ZFIN: ZDB-GENE-041014-293
Ensembl: ENSDARG00000069318
Vega: OTTDARG00000006375
UniProt: Q5SPP5
Position
20
AA seq 816 aa AA seqDB search
MTGVCGCCGALRPRYKRLVDNIFPEDPEDGLVKANMEKLTFYALSAPEKLDRIGAYLSER
LSRDVARHRYGYVCIAMEALDQLLMACHCQSINLFVESFLKMVRKLLEADKPNLQILGTN
SFVKFANIEEDTPSYHRSYDFFVSRFSEMCHSGYEDPDIRTKIRMAGIKGLQGVVRKTVN
DELQANIWDPQHMDKIVPSLLFNLQSGEGTESRSPSPLQASEKEKESPAELTERCFRELL
GRAAYGNIKNAVTPVLMHLDNHSLWEGKTFAVRCFKIIMYSIQSQHSHLVIQQLLGHLDA
NSKSSATVRAGIVEVLLEVAAIAASGSVGPTVLEVFNTLLRHLRLSVDYELTGSYDCTNI
GTKIIKEHEERQLQEAVIRTIGSFANTLPTYQRSEVMLFIMGKVPIPGLHPTLPSIGSGP
EGNRMIQVMLLKSLRQVTCGFQTTNMLTALPNSFLDPMLSFALLEDAEIRLLVLEILVSL
IDRHDNLPKFSNISIISDISVLKLKVDKCSRQDNLFMKKHAQHLYRHIYLCSKEQSSVQP
HFEKLYSLLALISMELANEEVVVDLIRVALALQDLALSSEEMLPVYNRCAIHALSSAYLN
LISQLTTVPAFCQHVHEVIEMRQKEIPYLLPEDVFIENPKIPKTLEKLEGDVLFQQAKIT
EVLGGSGYNTERLATPYVPQFTDEDRLSKRKSIGETISLQVEVDSRNSPEKEERTPAEEI
TFETLKNAIVDSVGVEEQEKERRRQVVEKFQKAPFEEIAAHCGARATMLQSKLNQIFEIT
IRPPPSPSGTITSSYGQTQSRSVPVYEMKFPDLCVY
NT seq 2451 nt NT seq  +upstreamnt  +downstreamnt
atgacaggggtgtgcggttgttgtggagcgctgaggcctcgctacaagagactggtggac
aacatctttccggaagacccggaggatggcttggtcaaggccaacatggagaaactgact
ttctatgccctgtcagctccagagaagctggatcggatcggggcatacctgtctgaaaga
ctgtcccgtgacgtagctagacatcgatatgggtatgtgtgtattgcgatggaagctctt
gaccagcttctaatggcctgccactgtcagagtatcaacctgtttgtagagagtttttta
aagatggtgcgaaaactcctggaagctgacaaacccaacctgcaaatcctaggaacaaat
tcatttgtgaagtttgccaacatcgaggaggacaccccttcgtatcaccgtagttatgat
ttctttgtatcacggtttagtgagatgtgtcactctggctatgaggaccctgacatccgc
actaaaatccgaatggctggaatcaaaggtctgcagggagtagtgagaaagactgttaat
gatgagttgcaggccaacatctgggatcctcagcacatggacaagatcgtcccgtcactc
ctcttcaatctgcagtctggtgaaggcacagagagtcgctctccctcgccgctgcaggcc
agtgagaaggagaaggaaagcccagctgagctgacggagcgctgctttcgggagctgctg
ggtcgagccgcttacggcaacatcaaaaacgcagtcacccctgtgttgatgcatcttgac
aatcactcactgtgggaaggcaaaacatttgcggtgcgctgttttaagatcatcatgtac
tccattcagtcccagcattctcatctggtcattcagcagctcttgggtcatttggatgcc
aacagtaagagctctgccacagtgcgtgctgggatagtggaggtgctcctggaagttgct
gccatcgctgccagtggctccgttggccccacggtgttggaggtttttaacacgctgctc
cggcatctgaggctcagtgtggactatgaactcacgggatcgtatgactgcactaacatc
ggcaccaaaatcatcaaggagcacgaggagaggcagctgcaggaagccgtcatccgcact
attggctcatttgcaaacacgttaccgacataccagcgctctgaggtgatgctcttcatc
atggggaaggtcccaattccaggcctgcatcctacactgccctctataggctcagggcct
gagggcaaccgaatgatccaagtcatgctgttgaagtctctgagacaggtcacgtgtggt
ttccagacaactaatatgcttacagctcttcccaactcctttctggatcccatgctgtca
tttgctctgctagaagatgctgaaattcggctgttggtgctggaaattctggtcagcctc
atcgatcgccatgataacctccccaagttctccaacatcagcatcatctctgatatctct
gtgcttaaactcaaagtggacaagtgctcacgtcaggacaacctcttcatgaagaagcat
gcgcagcacctctaccgacacatatatctgtgcagtaaggagcagagcagcgttcagcct
cactttgagaagctttattcactcctggccctcatcagcatggagctggccaatgaagag
gtggtggtagacctgatccgtgttgcgctcgctctgcaggatttggctctgagcagtgag
gagatgttaccggtgtacaaccgctgtgctattcatgccctgtcctctgcctatctcaat
ctcatcagtcagctcacaacagtgccagctttctgccagcatgttcatgaggtgattgaa
atgagacaaaaagaaattccttatctcttaccggaggatgtcttcattgaaaacccaaag
attcctaaaacactggagaagctggaaggagatgttttgttccagcaagccaagatcact
gaagttcttggaggaagcggctacaacactgaacgactcgctacaccttatgtcccacaa
ttcacagatgaagaccggctgtcaaagagaaagagtattggagaaacaatctctcttcag
gtggaggtggattccagaaacagtccagagaaagaggagagaacacctgctgaagaaatc
acatttgaaacacttaaaaatgccattgtggacagtgtaggagtggaggagcaggagaag
gaacgcaggagacaagtggtggagaagttccaaaaggccccgtttgaggaaatagctgcc
cactgtggtgccagagctacaatgctgcagagcaaacttaatcaaatctttgaaatcacc
atcaggcctcctcccagtccatctggaaccatcacatcaagttacggccaaacccagagt
cgctctgtccccgtttatgagatgaagtttccggatttgtgtgtttactag

DBGET integrated database retrieval system