KEGG   Danio rerio (zebrafish): 561647Help
Entry
561647            CDS       T01004                                 

Gene name
htr1b
Definition
(RefSeq) 5-hydroxytryptamine receptor 1B
  KO
K04153  5-hydroxytryptamine receptor 1
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    561647 (htr1b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:dre04030]
    561647 (htr1b)
G protein-coupled receptors [BR:dre04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    561647 (htr1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4 Peptidase_A22B
Motif
Other DBs
NCBI-GeneID: 561647
NCBI-ProteinID: NP_001122181
ZFIN: ZDB-GENE-081022-141
Ensembl: ENSDARG00000053987
Vega: OTTDARG00000038817
UniProt: B3DK14
Position
17
AA seq 380 aa AA seqDB search
MERSGYFKPTPAHFEVLNSSTGTNVTLTPKTDEKQESFAFQVTLSSVLGLITLATILSNA
FVIATISQSRKLQTPANFLIASLAVTDLLVSVLVMPICVLYTVTREWTLGQVICDIWLSS
DITCCTASILHLCVIALDRYWAITDAVEYAKKRTQARAAGMVATAWIIAISISLPPFFWR
QVKAGELTTCSVNTDHIFYTIYSTFGAFYIPTLLLIALYGRIYVEARKRILKQSPKKPGK
RLTSAHLSTNSPASVASTSPLHCGRQDLCSDSGSLGSDNQIRVTVSDSLLEKKRISAARE
RKATKTLGIILGAYIVCWLPFFIYTLLIPLCSSCFSPELFDFFTWLGYVNSLINPIIYTM
SNDDFKKAFHKVISFRCCRR
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcagcggttatttcaagccgacacctgcccatttcgaggtcttgaacagctcg
accggcaccaatgtgactttgacacctaaaacggacgaaaagcaagaaagtttcgctttc
caagtcaccttgtcgtcagttctgggtctcatcactctcgcaacaatattaagcaatgcg
tttgtcattgccaccatttcccaatccagaaagctccagacaccggcgaactttctgatc
gcgtcgctggccgtcacggaccttctggtgtcggtgctcgtgatgcccatttgcgtgctg
tacacggtcacccgcgagtggaccctcggccaggtcatctgcgacatctggctgtcctca
gacataacctgttgcaccgcgtccatacttcacctctgcgtaatcgccttggatcgatac
tgggcaataacggacgcggtcgagtacgccaagaaacgcacccaggcgcgcgccgcgggg
atggtggcgaccgcctggatcatcgccatctccatctccctgccgcctttcttctggcga
caggtgaaggcaggggagctgaccacctgctcggtcaacacagatcacatcttctacaca
atctactccacttttggggctttctacatccctacgctgctgctcatcgccctgtacggg
aggatttacgtggaggcgaggaagcgcattttgaagcagtcgcccaaaaaaccgggcaaa
agactcacctctgcacatctgagcactaattcgcccgcttcggtggcttcgacttcgcct
ttgcattgcggaaggcaggacctttgctcggacagcgggtctctgggcagtgacaatcaa
attagagtaactgtgtccgattcacttctggagaaaaagagaatatcggctgcgcgcgag
aggaaagccaccaaaaccctgggcattatattaggagcttatattgtgtgctggctgccg
tttttcatttacacactgttgattcccctctgttcgtcttgcttttccccagaactcttt
gactttttcacttggcttggctacgtcaactcactcatcaatcctataatatacaccatg
tccaatgatgactttaaaaaggcttttcataaagtcataagttttagatgttgcagacga
tag

DBGET integrated database retrieval system