KEGG   Danio rerio (zebrafish): 561669Help
Entry
561669            CDS       T01004                                 

Gene name
si:zfos-2326c3.2
Definition
(RefSeq) misshapen-like kinase 1 isoform X1
  KO
K04407  mitogen-activated protein kinase kinase kinase kinase 4 [EC:2.7.11.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    561669 (si:zfos-2326c3.2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    561669 (si:zfos-2326c3.2)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     561669 (si:zfos-2326c3.2)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: STE group
  STE20 family
   561669 (si:zfos-2326c3.2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CNH Pkinase_Tyr Kinase-like APH
Motif
Other DBs
NCBI-GeneID: 561669
NCBI-ProteinID: XP_009306038
ZFIN: ZDB-GENE-091113-25
Ensembl: ENSDARG00000098680
Vega: OTTDARG00000036467
Position
14
AA seq 1165 aa AA seqDB search
MARDFTTTSLSNIDLASLRDPAGIFELIEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTE
DEEDEIKLEINMLKTHSHHRNIATYYGAFVKKSPAGQDDQLWLVMEYCGAGSVTDLLKKT
KGNCLKEDWIAYVCREVLRGLLHLHSHHVIHRDIKGQNVLLTENAEIKLVDFGVSAQLDR
TIGRRNTFIGTPYWMAPEVIACDENPDSTYDYRSDVWSLGITALEMAEGVPPLCDMHPMR
ALFLIPRNPPPKLKSKKWSKKFQTFVDSCLVKNYLHRPSTETLLRHSFIKDLPNERQVRI
TLKDHLDRTRKRRQEKDGKEYEYSGSEDEDDGINEEEGEPSSIVNLPGESMLRREFLRLQ
QETNSQTQLIQQVHNQDNYKKQLLADRQKRIQQQQEERRRFEDHQERLLHETGVQWPELQ
EMLWQEETDLTEKSKRNHKKQPKDSEHHRTDVESASSNLFDEQAQGRKAQRTLPRDQSQL
LFLLHDHTHQQKSSRATPHDGLAGKLESLETHLVNLNNLAVRIPHVQSRLGSGSNSSPCT
PALQRAVKQPNMNVCSSQEIHHSSSMSDVNAPLSPTLDDVFFTPDDQPPKIPERTTSKFK
DVMGHHRYGSSGDRQSAMDNAVKMSFSNSSTSSSQSGYCVLDNPAHPNRNSQSPGASPHN
QGLGTKSQFSPLMKLAEYSSSSDEDDEKMRSPSSNGRPVFSRGQTNEIILQPHLNVKQQQ
QSAAKPTHNVYQRPCGSQSSDNYHLPDLLHKSPTHELSYHQTPTQSSRDKLLNNQPGKSV
SSSSSSFSAFIDPRLLQISPPLSPQGHGQLNGRCEPCVRQPHRKGSVVNVNPTNIRPQSD
APEIRKYKKKFNAEILCASLWGVNLLVGTENGLWLLDRSGQGKVYSLISRRRFQQMDVLE
GLNVLITISGKKNKLRLYYLSWLRNKILHNDPEVEKKQGWTSVGDLEGCVSYKVVRYEKI
KFLVIALRNAVEVYAWAPKPYHKFMAFKSFSSLPQKPLSVDLTVENGQRLKVIYGSHNGF
HAIDVDSGTPFDLYLPSHIQGLIRPHAIIILPSSSGMELLLCYEDEGVYIDTYGRITKET
VLQWGEMPASVAYLQANQVMGWGEKAIELRSAKTGSLEGVFMHKKAQKLKFLCERNDKVF
FASVQSGGSSQIYFMTLGQNSLFSW
NT seq 3498 nt NT seq  +upstreamnt  +downstreamnt
atggcgagagacttcactacaacaagtctgagcaacatcgacctcgcctctttacgggat
cctgcggggatattcgagctcatagaagtggtcggaaatgggacgtatggacaagtttac
aagggtcgacatgtgaaaacaggacagctggcagcgatcaaggtcatggacgtgacagag
gacgaggaagatgaaatcaaactggagattaacatgttgaaaactcattcccatcacaga
aacattgccacatattatggtgcctttgtcaagaaaagtcctgcaggtcaggatgaccag
ctttggctggtgatggagtattgtggcgctgggtcggtcacagacctgctgaagaagacc
aaagggaactgccttaaggaggactggatcgcttacgtctgcagagaggttctcaggggt
ctgttacacttgcactcgcatcatgtgattcacagagacattaaaggacaaaatgtgctt
ctgacagagaacgctgagattaaactcgtggattttggagtcagtgctcagttagacagg
acgattggaagaagaaacacatttatcgggacgccatattggatggcgccggaggtcata
gcatgcgatgaaaacccagactcaacatatgactataggagtgatgtgtggtctctgggt
atcaccgctttggagatggcagagggagtgccacccttgtgtgatatgcatccaatgaga
gcgttgtttctcattccacgaaaccctcctcccaaactaaagtctaagaaatggtctaaa
aagtttcagacttttgtggacagttgtctggtgaagaactacctccacaggccatccaca
gagacgcttttacggcattcctttattaaagaccttcccaatgaacgacaagtacgaatc
acacttaaagatcatctggacagaaccaggaagaggagacaagagaaagatgggaaggaa
tatgaatatagtggaagtgaagatgaagacgatggtataaatgaagaagaaggtgaaccc
agctctatagtgaaccttcccggagagtccatgcttagacgagagttcctgcgactgcag
caggagacgaactcccaaacgcaactaatccagcaagtacacaatcaagacaactacaag
aaacaactgctggctgacagacagaagagaatccaacaacagcaggaggagcgacgacgc
ttcgaagatcatcaggaaaggctgttacatgagactggagtccagtggcctgagcttcag
gagatgttatggcaagaagagactgaccttactgagaaaagcaaaagaaatcataaaaaa
cagcctaaagacagtgaacatcacaggactgatgttgaatctgcatcttcaaatcttttc
gatgagcaggctcagggcagaaaagctcagcgcacacttccccgagatcagtcacagctg
ctgttcctcctgcatgaccacacacaccagcagaagagcagcagagctacaccacatgac
gggctggcaggtaaactggagtccctggaaacccatcttgtgaatctgaataatctagct
gtcaggattcctcatgttcagtcccgtctgggatcaggaagcaactccagtccctgcact
ccagcgctccagagagctgtgaaacagccgaacatgaacgtgtgttccagtcaagagatt
catcacagcagctcgatgtcagatgttaatgctccactctctccaacactggatgatgtc
ttcttcacccctgatgatcaaccaccaaagattccagaacgaaccacatcaaaattcaaa
gatgtcatgggccatcacagatacggatccagtggagatcgtcagtcggctatggacaac
gctgtcaaaatgtctttctccaacagctcgacaagcagctcacagtcagggtactgtgtt
ctggataatccagctcatccaaacagaaactctcaaagtccaggagcatcaccacacaac
cagggtttgggaacaaagtctcagttcagcccattgatgaagcttgcagaatattcttca
tccagtgatgaagatgatgagaagatgaggtctccatcgagcaatggaaggcctgtgttt
tccagagggcagactaatgaaatcattcttcagcctcatctcaatgtaaaacagcagcag
cagagtgcagcaaagccaacacataacgtatatcagaggccttgtggttcacaatctagt
gataactaccatctgccagacctcctgcacaaaagccccacacacgagctgagctaccac
cagacccctacacagagctccagagacaaactactcaataaccagccaggaaaaagcgtg
tcttcttcatcttcctcattctcagctttcattgaccctcgtttgcttcagatttctcca
cctctgagtccgcagggacacggccagctgaatggcaggtgtgagccatgcgttagacag
cctcacaggaagggctcagtggtgaacgtcaaccccaccaacattcgaccacagagtgac
gccccagagattcgcaaatataaaaagaagttcaacgctgagatcctctgtgctagtctg
tggggtgtgaatttgttggtgggtacagagaatggcctgtggctgctggaccgcagtggt
cagggtaaagtttactctctcatcagtcgcagacgcttccaacagatggacgtgctggag
ggcctcaatgtactcattactatatcaggtaagaaaaacaagctgaggctgtactacctg
tcatggctgaggaataagatcctgcataatgatccagaggtggaaaagaaacagggctgg
acctctgtgggggacctggagggatgtgtcagctacaaagtagttcgctatgaaaaaatc
aagttcctggtcatcgctttgaggaatgctgtggaggtctacgcttgggctccaaagcca
tatcacaagttcatggctttcaaatccttcagctctctgcctcagaagcccctctccgtg
gacctgacggtggagaatggacagaggttaaaggtcatctatgggtctcacaacggtttc
catgctatcgatgtggactcagggactccatttgatctttacctacccagtcatatccaa
ggtttgattcggcctcatgccatcatcatcctccccagcagcagtgggatggagctgttg
ctgtgttacgaggacgagggcgtctatattgacacctatggccgcatcaccaaggagaca
gtgctgcagtggggggagatgcccgcctctgttgcttaccttcaggcaaatcaggtgatg
ggatggggagagaaagccattgaactgagatctgccaagactgggagtctggagggagtc
ttcatgcacaaaaaggctcagaagctcaagttcctgtgtgaaagaaacgataaagtgttt
ttcgcttcagtccagtctggaggcagcagtcagatctacttcatgacattaggacagaac
tccctcttcagctggtga

DBGET integrated database retrieval system