KEGG   Danio rerio (zebrafish): 561772
Entry
561772            CDS       T01004                                 

Gene name
nfatc3a
Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 3
  KO
K17333  nuclear factor of activated T-cells, cytoplasmic 3
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04218  Cellular senescence
dre04310  Wnt signaling pathway
dre04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    561772 (nfatc3a)
   04310 Wnt signaling pathway
    561772 (nfatc3a)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    561772 (nfatc3a)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    561772 (nfatc3a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dre03000]
    561772 (nfatc3a)
Transcription factors [BR:dre03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    561772 (nfatc3a)
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG DUF3304
Other DBs
NCBI-GeneID: 561772
NCBI-ProteinID: XP_021333591
ZFIN: ZDB-GENE-041111-41
Ensembl: ENSDARG00000076297
Vega: OTTDARG00000041465
Position
7
AA seq 1074 aa
MTTANCPGNEELDFRLIFGEDGQQPPLGPADLETDDNTSFYILNVGQPPSLVNQSHGIQR
HGGPPPSQFISSSPSLQALHKIYEPSYEPQDSKYTPTGVGGGGNGPPKAFECPSIQITSI
SPSCQQEMEASEDEMRSKGPDGDYHDRPLSRDHLYLPLDHSYRDSSLSPSPCSSLSSRSW
FSDASSCESISHVYDDVDSELNEAAARFTLGSPLTSPGCSPQTGTQEEVWQQQHHHHHPA
FAHSLSHSHGHSLSPRQSPCHSPRTSVTDENWLSPRSPSRPSSRPTSPCGKRRHSSADIC
YLGSLSPHHSPTATPGPSPRGSVTEDTWIGSPSMGVSPFQCCPSEADIPSKTRKTSQDCT
AVIQPGKGDLSMDDSGNGSPLLDSPAEDSMHGLKKDGSGEQFLSVPSHFTWNKPKPGHTP
IFRASNLPPLDWPLPNQYGQYELKIEVQPKAHHRAHYETEGSRGAIKATSGGHPIIKLLG
YNEKPVNLQMFIGTADDRYLRPHAFYQVHRITGKTVATASQEIIITSTKVLEIPLLPENN
MSASIDCAGILKLRNSDIELRKGETDIGRKNTRVRVVFRVHIPQPNGKVVSLQSSSVPVE
CSQRSAQELPQVEKASISSCPVSGREEMLITGSNFFPESKVIFLEKGPDGRPQWEVEAKI
IREKSQGSSIAVEVPPYHSKTVTSAVQVQFYVCNGKRKRSQSQRFTYLPVLVKQEHRDDL
DSPAVPPMSMPLVHAASLVCAQPLSSPEHSHPPDGLLSSSPRGLAAGLHPLQAPCAPMGS
PTLPHLPHLQARGLNAPPECQMPFHPGPAATARPSYPPIQHNMPFNGQQSLPMTAGSPQA
YERMPFQADPAGCHTLGVGMVYGPASSTPPSGVPPGPGSSPSHVACTGSNQVMAHSAPHL
HSLGYHHPTPGQIPSPTHTLGQPPPQLQRPLVYHPAGQRSASCPTPSSAPAHMVPSPHSG
PSSPQLHSLPYHSPTSPSPTSNSPLGPMALSGQPSPQASSPVLAGLSPSGPLAHPLAQQG
ERLNIKQEPEDREPTFRTIGLQDITLDDVNEIIGRDMSQAPGAHGGSPSAHSQS
NT seq 3225 nt   +upstreamnt  +downstreamnt
atgactactgcaaactgccccgggaatgaagagctggacttcagactgatcttcggggag
gacgggcagcagccgccgctaggccccgcagatttggaaacggatgacaacacatcattt
tacatcctcaacgtgggccaacccccttcactggtgaaccaatcgcatggtatccagcgt
catggaggcccgcccccatctcagttcatcagctcctccccttctctgcaggccctccac
aaaatctacgagcccagctatgagcctcaggactctaaatacacacccacaggagtgggc
ggaggagggaacgggccaccaaaagcctttgaatgtcccagcatccagatcacctccatc
tctccaagctgccagcaggagatggaggccagcgaggatgagatgcgatcgaagggtccg
gatggagattaccatgacagacctctgtctcgggaccatctgtacctcccactagatcac
tcttatcgagattcgtccctgagcccgagcccatgtagcagcctttcctctcgtagctgg
ttttcagatgcctcgtcctgtgaatccatctctcatgtgtatgatgacgtggattcagaa
ctgaatgaagcagcagcacgtttcaccctgggctcaccgctcacctcacccggctgctct
ccacaaactggcacacaggaggaagtttggcagcagcagcaccatcatcatcacccagcc
ttcgctcactccctttctcattcgcacggtcattctttgtcacctcgtcagtcgccctgc
cactcgccccgcaccagcgtcaccgatgagaactggctgagccctcgctccccttcacgg
ccctcttctcgcccaacatcgccctgtgggaagagacgccactccagtgctgatatttgc
tacctgggctctttatcaccccatcactccccaacagccactccaggcccttcacccagg
ggcagcgtgactgaggacacgtggataggtagcccgtccatgggtgtatctcctttccaa
tgttgcccctctgaagctgacatcccctccaaaacaaggaagacgtcccaggactgtaca
gcagtaattcagcctgggaaaggtgacctgagcatggatgattctgggaatgggtctcct
ttgcttgactcgcctgctgaggactccatgcatggattaaagaaagatggttctggagag
cagtttctttctgtcccatctcacttcacatggaacaaacccaaaccaggacacactcct
attttcagagcatcgaatctgcctcccctggactggccgttgccaaatcagtatgggcag
tatgagctaaagatcgaggttcaacctaaagcacatcacagagctcattacgagaccgaa
ggcagccgaggggccatcaaagccacgtccgggggacaccctatcatcaagcttcttggc
tacaacgagaagccagtgaacttgcagatgttcatcgggacagcggatgaccgttattta
aggccacatgctttctaccaggtccaccgcatcacaggaaaaaccgtggctacggcaagc
caggaaattatcatcaccagcacgaaggttctcgagattcctctccttcctgaaaacaat
atgtctgccagtattgattgtgctggaatcctgaagttgaggaactctgacatcgagctg
aggaaaggagagactgatattggacggaaaaacactcgggtgcgcgtggtgttccgggtt
cacatcccacaacccaatggaaaagtggtctcactgcagtcctcatcagttccagtggag
tgctctcagcgctcagcacaggagttaccccaagtggagaaggccagtatcagcagttgc
ccagtgagtggaagagaggaaatgctcatcactggctccaacttcttccccgagtcaaag
gtcatttttctggagaaaggtccagatggacgaccgcagtgggaggtggaagcaaagatc
attagagagaagagtcaaggatcaagcattgcggtggaggtgcctccgtaccacagtaag
acggtcacttcagcagtgcaggtgcagttttacgtgtgcaatggaaagcggaaaagaagc
cagtcgcaacgcttcacctatctgccagtcctggtcaagcaagaacatagggatgatctg
gactcccctgccgtgccgcccatgtcaatgcctctggtccatgctgccagtttggtctgc
gctcagccgctgtcctccccagagcactcccacccaccagacggccttctgtccagctcc
ccacgtggcctggctgcaggcctgcaccctctccaggccccctgcgccccaatgggctcc
ccaactcttccccacctgccccaccttcaggctcgtgggctgaatgcacctcccgaatgc
cagatgcccttccacccaggccctgctgccactgccaggccatcttacccccccatacag
cacaacatgcccttcaatggccagcagagtcttcctatgactgcaggctccccacaggcc
tacgagcggatgcccttccaggctgatccagctgggtgtcacaccctgggtgtggggatg
gtttatggcccggcttcttcaacacccccctctggagtgccgccgggtcctggctcaagc
cccagccatgtagcttgtacaggtagtaaccaggtcatggcccattctgccccacacctt
cactctttaggctatcaccaccccactccaggccagataccatcgcccactcacaccctg
ggacagccgcccccacagctccaacgtccactggtttaccatccagccgggcagcgttct
gcctcctgccccacgccgtccagtgctccagctcatatggtgccatctccccactctggg
ccctcatccccccagctccattcgctcccataccactcgcccacctccccttctcctaca
tccaacagccccctggggcccatggcactctctggacagccttcgcctcaggctagcagc
cctgtcttagctgggttgtctccttcaggtcctttggcacaccccctggcccagcaagga
gagaggctgaacatcaagcaggagccagaggacagagagcccaccttccgcaccattggc
cttcaggacataacacttgatgatgtgaatgagatcatcggcagagacatgtctcaggcc
ccaggggctcatggaggatctccatcagcacacagtcaatcctag

DBGET integrated database retrieval system