KEGG   Danio rerio (zebrafish): 561788
Entry
561788            CDS       T01004                                 

Gene name
kif22
Definition
(RefSeq) kinesin-like protein KIF22
  KO
K10403  kinesin family member 22
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:dre00001]
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    561788 (kif22)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:dre04812]
    561788 (kif22)
Cytoskeleton proteins [BR:dre04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     561788 (kif22)
SSDB
Motif
Pfam: Kinesin Microtub_bd HHH_3 HHH_6 NAM-associated
Other DBs
NCBI-GeneID: 561788
NCBI-ProteinID: NP_001107063
ZFIN: ZDB-GENE-080204-34
Ensembl: ENSDARG00000102624
Vega: OTTDARG00000040116
UniProt: A8WFU8
Position
12
AA seq 634 aa
MAQRVAVNDGAAGSKRTSRVRVAVRLRPYMDKQDEKSEGSCVRGLGPQKLEIINWRNATE
TLQYQFDVFHGEETTQQEVFLTSVKPILPHILNGQNASVFAYGPTGAGKTHTMLGSQEQP
GVIPRAVKEVFNLVGAQKKEQDGWEYSIGMSYLEIYNEKVLDLLSPGSQDLPIREDKDRN
ILIPGLTHTPLSSFADFDTHFIPASLNRTTASTKLNQRSSRSHAILLIKVVKSQRGPPHR
QQTGKLYLVDLAGSEDNRRTGNQGIRLKESGAINLSLFTLSKVVDALNTGAGGRVPYRDS
KLTRLLQDSLGGSAHSVMITNIAPEYKYYFDTFSALNFAAKSKQIVNRPFVRETVLAPTI
APGKRTREEQEAGGSGEPQNKRSKEGKKAEHSPSPPLHPQSSPDSSVLDRLLALEKMMMG
SAERERLNLLKTVAQSRKEIQMLKEKQKELEDKANMFNKQKETTEKESKDALLFKTDLPP
LHRKQSTAAKPRKQQAVVTPLQVSQVQPLQQCAVVCKPSQTLVKKKRVQTEVCDGKENIG
VDLPPVEDVNWESRLDPALLEQSRKKILQTLNSGSLKELKSLQQIGDKKAKLIMGWREIN
GDFTQVEDLKKIEGVTVKRFSSFIKANILSSMGK
NT seq 1905 nt   +upstreamnt  +downstreamnt
atggcacagcgtgttgctgtgaacgatggagctgctggatccaaacgcacctctcgtgtt
cgagtggccgtccggctgagaccctacatggacaagcaggacgagaagagcgagggctcc
tgtgtgcggggtctggggccacagaagctggagatcatcaactggaggaacgccactgag
accctgcagtaccagtttgatgtgtttcatggtgaagagaccacacagcaggaggtgttt
ctgacctccgtcaagccaatcctcccacacatcctcaatggtcagaatgccagtgtcttt
gcctacggacccaccggagcaggaaagacccacaccatgctgggcagtcaagagcagcca
ggcgttattcccagagctgtaaaggaggtcttcaatctggttggagctcagaaaaaagag
caagatggttgggagtactccattgggatgtcttacttggaaatctacaatgaaaaggtg
ctggatctgttgtccccaggttcccaggacctgcccatccgtgaagacaaggacagaaac
atcctcattcccgggttaacacacactcctctctcatcttttgctgattttgacactcat
ttcatccccgcaagcctcaaccgaaccacagcctctactaaactcaaccagcgctccagc
cgcagtcacgccatcctcctcataaaggtggtgaagtctcagcgtggtccgccacacaga
cagcaaacaggaaagctttatttggtggatcttgccggttcagaggacaatcggcgcaca
ggaaaccagggcattcgtctgaaagagagcggagccatcaacctgtctctgttcacgctc
agtaaggtggtggacgctctgaacacgggggctgggggccgcgtgccctacagagacagt
aaactcacccgcctgctgcaagactctttgggtggatccgcacattctgtcatgatcaca
aacatcgcacccgagtacaaatactactttgacaccttttctgcacttaatttcgccgca
aagtctaagcagattgtcaatcggccctttgtcagagaaactgttttggcccctacgatt
gctcctggaaagagaaccagagaggaacaggaggctggaggttctggtgaaccccagaac
aagaggtccaaagaagggaagaaagctgaacattccccatcaccgcccttacatccacag
agttcaccagattcatcagttctggaccgactcctggctctggagaagatgatgatgggc
tcagctgagagggagagactcaacctgctcaaaactgttgcacagtcccgaaaagaaatc
cagatgttgaaggagaaacagaaggagctggaggacaaagccaacatgtttaataagcag
aaagaaaccaccgagaaagagtccaaagatgctcttcttttcaagacagatctgccgccc
ctacacagaaaacagtcgacagccgccaaaccacgcaaacagcaggccgttgttactcca
ttacaggtgtctcaggtgcagcccttacagcagtgtgcagtggtctgcaaaccctcacag
accttggttaagaagaaacgtgtccaaacggaggtgtgtgatggaaaggaaaacataggt
gtggatcttcctcctgttgaagatgtcaactgggagtcccgtctggatccagcattactg
gaacagtccaggaagaagatcctgcagacgctcaactcgggctctctgaaggagctcaag
agcctgcagcagatcggagacaagaaggccaaactcatcatgggctggagagagattaat
ggagacttcacacaggtggaagacctgaagaaaatcgaaggtgttacagtaaaacgattc
tcttctttcataaaggccaatattctcagcagtatgggaaaatga

DBGET integrated database retrieval system