KEGG   Danio rerio (zebrafish): 562007Help
Entry
562007            CDS       T01004                                 

Gene name
irg1l
Definition
(RefSeq) immunoresponsive gene 1, like
  KO
K17724  aconitate decarboxylase [EC:4.1.1.6]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    562007 (irg1l)
Enzymes [BR:dre01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.6  cis-aconitate decarboxylase
     562007 (irg1l)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MmgE_PrpD
Motif
Other DBs
NCBI-GeneID: 562007
NCBI-ProteinID: NP_001071075
ZFIN: ZDB-GENE-061103-301
Ensembl: ENSDARG00000062788
Vega: OTTDARG00000028290
UniProt: A0JMM8
Position
14
AA seq 498 aa AA seqDB search
MLSAVQRSSRYLTSFSAARGLHKSALDVAERPAPEETVTSSFGRFIQSVQPKNLTPTVLQ
RSKRMVLDSIGVGLVGSTTEVFDLALQHCQHMYASDDISFVYGRQGVKLSPTLAAFVNGV
AAHSMDFDDTWHPATHPSGAVLPALLAISDMLHSNSKPSGLDFLTAFNVGIEIQGRLMRF
SNEAHNIPKRFHPPSVVGTLGSAAACARLLSLDRNQASNALAIAASLAGAPMANAATQSK
PLHIGNASRLGLEAALLASRGLEASPLVLDAVPGVAGFSAFYEDYAPRPIGSPEEDEHSF
LIESQDIAFKRFPAHLGMHWIADAASVVHKTLVGLKGGSISPNLVQDILLRVPLSKYINR
PFPESEHQARHSFQFNACTALLDGEVTVQSFHPEAIQRPELHALLSRVRLEHPSDNPANF
NIMYGEVEVTLVTGDVLRGRCDTFYGHWRNPLSQESLHKKFRNNAGTVLSTEKVERLIEA
VESLDRSDDCKQLLAQLQ
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgctttcagcggtacagagatcttccagatacctgacttccttctcggctgcccgagga
ctgcataaatctgcactagatgtggcagagcgtcctgctcctgaggaaacagtcactagc
agctttggcaggtttattcagagcgtacagccaaagaatctgacaccaacagtgctacag
cgcagcaaacgcatggttttagacagcattggagttgggcttgtgggaagcaccactgag
gtgtttgatcttgcccttcagcactgccagcacatgtatgcttctgacgacatcagtttt
gtctatgggcgccaaggtgtgaagctttctccaacgcttgctgcttttgtcaatggagta
gcagctcactcgatggactttgatgatacttggcatcctgcaactcacccctctggagca
gtactgcctgccctcctggctatcagcgacatgctgcacagcaacagcaaaccaagcggg
cttgactttctaaccgcattcaatgtgggcattgaaatacaaggccgactgatgagattc
tccaatgaggctcacaacatccctaagaggttccatcctccaagtgtggtgggcactctg
ggtagtgctgctgcctgtgctcgcctcctttctctggatcgcaaccaagccagtaatgct
ttggccatcgctgcatctttggcaggtgcaccaatggctaatgctgcaacacaatctaaa
cctcttcacatcggaaatgcttcacgtctaggtctcgaagcagccctgctggcatctcgt
gggttagaagcaagtcctctagttttagatgcagtacctggcgttgctggcttcagcgct
ttctatgaagactatgccccacgtcccattggatcccctgaggaggatgaacacagcttt
ctgatagagtcacaagacatcgctttcaagcgctttcctgcacatctgggaatgcactgg
attgctgatgctgcttctgttgtgcacaagaccctggttgggctaaaaggaggcagcatt
tctccaaatctggtgcaggacatcctgcttagggtgccactctccaaatacatcaatcgt
ccattcccagagtcagagcaccaggcgcgccattctttccagttcaacgcctgcactgct
ttgctggatggagaagtgacagtgcaatccttccacccagaagccattcaacggccagaa
cttcatgcacttctctcccgtgtccgtttagagcaccccagtgacaacccagccaatttc
aacataatgtatggtgaggttgaggttaccttggtaaccggagatgtcttaagaggacgc
tgcgacactttctacggtcactggaggaaccctcttagccaagaaagcctccataagaag
ttccgtaacaacgcaggcacagtgctgtccacagagaaggtggaaaggctcattgaagcc
gttgagagcctggatcgatcagatgactgtaaacaactgcttgcccaactgcaataa

DBGET integrated database retrieval system