KEGG   Danio rerio (zebrafish): 562072Help
Entry
562072            CDS       T01004                                 

Gene name
ltbp1
Definition
(RefSeq) latent-transforming growth factor beta-binding protein 1 isoform X1
  KO
K19559  latent transforming growth factor beta binding protein 1
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    562072 (ltbp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF_CA cEGF TB EGF hEGF EGF_3 Plasmod_Pvs28 FXa_inhibition
Motif
Other DBs
NCBI-GeneID: 562072
NCBI-ProteinID: XP_017207300
ZFIN: ZDB-GENE-091202-8
Ensembl: ENSDARG00000056922
Vega: OTTDARG00000038680
Position
17
AA seq 1527 aa AA seqDB search
MAMLVWDIIVSVTLLISPAFLSADQSGFRKLYVVQPGPSGTDGVHVSSISSLSGASGQPH
SYNVELKASFGGQVRTRRMGHQQNPSIPIRQDAQSGRHTSSHHMKVSGVNVCGGQCCVGW
SKTPGSQRCTKPNCTPPCKNGGMCLGPHMCVCKPGSKGKSCEQTTLPPSSHPTGPLNGHT
NGGVPNGGHTNGYSNGHNVIPQRPIPQQIFPQGQGQVPLPLPGTNVGHLTLSMKPSVNGP
IPYQPQIQNPVSMTMHQSKSQKFLVQQKNYHTHTQMQGVGPTLNRAIPLSVGHNPIHVGN
HTGRIKVVFTPTICKMTCTNGRCQNSCQKGNTTTIISENGHATDTLTAPNFRVVVCHLPC
MNGGKCSARDKCQCPPNFTGKFCQMASPNGHQGQHTVVNGQKTHVHSTHTLPLTYGTGQN
QGMVNVHVKHPPEASVQIHQVSPVDSNGQVKNTQSSHSFTYHSSSQSIQHGHTHSGVIYP
NQQTYLQYQPVTSKSQLGRCFQETTGMQCGKALPGLSKQDACCGTVGTSWGFHKCQKCPK
KPSIPLIECPQGYKRLNGTRCIDIDECQLQGVCPNGNCINTVGSYRCICNPGFVPDPSLT
SCFPETPALREEKGACFRFVGSGKQCLHPVSTQLSKQLCCCSVGKAWGPHCDRCPLPGTA
AFKDICPGGMGYHVTPPYIYKPKPPNGHTQTDSQGYNNPTIRHQVPMDPPVPFPTLQQPV
EALSITERQLPEVVEKVSPPAPVAIPPSNEGQDITPTQLAEIDECVVRPDICGAGICYNT
AESYTCFCDDGYRTDSEGTTCVDVDECAENPSLCANGRCQNTPGGFLCVCELGFMPNERG
SSCSDIDECQNRRACPSGLCYNTLGSFMCSPCPDGFEGKNGQCVDINECLDKRVCAHGQC
SNLEGYFVCTCDEGFLPTPDGKSCTDIDECQDDNVCIQGHCQNTQGSFICNCEPGFKLSS
SGDQCEDVDECLVIPQTCDGVGQCVNILGSYQCNCPQGYRQVNSTSCLDVDECEDDTQLC
IPNGECLNTEGSFLCVCDAGFVSTRTGCQDVDECSLNENTCGSHGTCQNTIGSFICQCDP
GFKDSQDGQGCVDVNECELLGNVCGEATCENREGTFLCLCPDDLQEFDPMLGKCISTPPV
TTVERKECYFNLNDENLCDKVLASSMTKEECCCTLGAGWGDNCEVHPCPIPGTDQFSQMC
PAGRGYLISGDPMSTTSSLAENTKADADECQLFGSEICKDGFCLNTAGWYECYCKSGLYY
DESKLQCLDTDECQDEAKCRDGECMNTYGSYQCFCTPPMVLAMDNTHCILPDVAGQSEAD
LYSGVCWERVTENFSCANPIPNIHTSFTECCCLYGEAWGNDCALCPGKNTDSYAQMCNIR
RPYGRDALVAGPIGVSPDYNPQPLNPDGTLPYIEDYDEPRNPYDAFEGLRAEECGVLNGC
ENGRCVRVQEGYTCDCFDGYTLDMSRMACVDINECSELNAKMSLCKNGNCINTQGSYKCV
CLPGFILSAQHNYCVPHRQNATSTGTE
NT seq 4584 nt NT seq  +upstreamnt  +downstreamnt
atggctatgctcgtgtgggacatcattgtttctgttacgttattaatttctccggctttt
ctttcggcggatcagagcggcttcaggaaactgtacgttgtgcaaccgggaccgagcggt
acggacggggttcacgtgagctccatttcatcgctctcgggagcgtcgggacagccacac
tcatacaatgtggagctgaaagccagcttcggtggccaggtccggacccgcagaatgggt
caccagcagaacccgagcattccgatccgccaggacgcgcagtctggccgacacacatcc
agccatcacatgaaagtgtcaggagtgaacgtctgtggggggcagtgctgtgttggttgg
agcaagaccccaggatctcagcgctgcactaaacctaactgtacacccccatgcaaaaat
ggagggatgtgcttggggccccacatgtgtgtgtgtaagccaggctctaaaggcaagtcc
tgtgaacagaccactctccctccatcctctcatccaactggaccactaaatggacacacc
aatggtggagtcccaaacggaggtcatacgaacggatactccaacggtcataatgtaatt
ccccagcgccccattcctcagcagatcttcccacaggggcaaggtcaagtaccattacca
ctgcccggcaccaacgttggacatttaactctgtccatgaagccgtcagttaatggaccc
attccatatcaaccacaaatacaaaacccagtttcgatgacgatgcaccagagtaagtcc
caaaagtttttggtccagcagaaaaactaccacacacacacgcagatgcaaggagtggga
cccaccttgaaccgtgccatcccgctgtcagtgggccacaacccaattcatgtggggaac
cacacaggccggatcaaggtggtcttcactccgactatctgcaagatgacctgcaccaac
ggccgctgtcagaacagctgtcagaagggaaacaccaccactatcatcagtgagaacgga
cacgccaccgacacgctcaccgcccccaacttcagagttgttgtttgccatttgccctgc
atgaatggtggaaaatgcagcgctcgggataagtgccagtgcccgccaaactttactgga
aaattctgccaaatggcgagtccaaatggtcaccaggggcagcatactgttgtaaatggg
cagaagacacatgtccactcaacacacacgttacccctcacttatggcactggacaaaac
caaggtatggtgaatgtccatgtgaaacatcctcctgaagcctcggtccagattcatcag
gtgtctccagtggacagtaatggacaagtgaagaacacgcagtccagccattccttcacc
taccacagcagcagccagagcatccagcatgggcacactcacagtggtgtcatttacccc
aaccagcaaacatacctccaataccagcctgtcacatccaagagccaactaggacgctgc
ttccaggagactaccggaatgcagtgtgggaaagctctgcctggactatctaaacaggat
gcctgttgtgggacggtgggcacatcatggggattccacaaatgccaaaaatgccccaag
aaaccatcgattcctttgattgaatgtcctcaaggctataagagactgaatggcactcgc
tgtatcgacattgatgaatgtcagcttcaaggtgtttgtccaaatggaaactgcatcaac
actgtgggcagctataggtgtatctgcaacccaggctttgtgcctgatccatcactgacg
tcctgcttccccgaaacacctgctcttcgcgaggagaagggtgcttgcttccggtttgtc
ggttcagggaagcagtgcttgcaccctgtgtccactcagctgagtaaacagttatgctgt
tgtagtgtgggcaaggcctggggtcctcattgtgaccgctgtcctctacctgggacagct
gcgtttaaagacatttgtcctggaggtatgggttaccacgtcaccccaccatacatttac
aagcccaaacctcctaatggacacactcagacagacagtcaggggtacaacaatcccacc
atcagacaccaagtccctatggatcctccagtgcccttccccaccctccagcagcccgtg
gaggctctgagcatcacagagagacagctgcctgaggtggtggagaaagtgtcaccaccg
gctccagtggcaattccaccttccaatgaaggtcaggacattaccccaacacagctggct
gagattgacgagtgtgtagtgagacctgatatctgtggtgcaggaatctgttataacact
gctgagagctacacatgcttctgtgatgacggctatagaacggacagtgagggcaccaca
tgtgtagatgtcgacgagtgtgcggagaacccaagtttgtgtgctaatggccgttgtcag
aacactccaggcggattcctgtgtgtatgtgagcttggcttcatgcctaacgagaggggc
agcagctgttccgatattgatgaatgtcagaacaggagagcgtgtccatctggtctctgc
tataacactttgggctcattcatgtgttctccctgtccggatgggtttgaaggaaaaaac
ggccaatgtgtagatataaatgagtgtctggataaaagagtgtgcgctcatggtcagtgc
tctaatctggagggctatttcgtctgcacgtgtgatgaagggttcttgcccactcctgat
ggcaaaagctgcacagacattgatgaatgtcaggacgataacgtgtgtatccaaggtcac
tgtcaaaacacacaggggtcattcatctgcaactgtgagcctggcttcaaactgtcgtcc
tcaggagaccaatgtgaagatgtggatgagtgtttggtgatacctcagacctgtgatggt
gtgggccagtgcgtcaatatcttagggtcttaccagtgcaattgcccacaggggtataga
caagtcaatagcaccagctgccttgatgttgatgaatgtgaagatgatacacaactgtgt
atcccgaatggagaatgtttgaacactgagggttcattcctgtgtgtgtgtgatgctggc
tttgtgtccaccaggacaggctgtcaggatgtggatgagtgttctctgaatgagaatacc
tgtggaagtcatggtacttgtcagaatacaataggctccttcatctgccagtgcgacccg
ggatttaaggactctcaggatgggcagggctgtgtggatgtgaatgagtgtgagcttctc
ggtaatgtgtgtggtgaagccacctgtgagaaccgtgaaggcaccttcctgtgtttgtgt
cctgatgacctgcaagagtttgacccaatgcttggcaaatgcatctctacacctccagtc
acaacggttgagaggaaagagtgttacttcaacctgaatgatgaaaacctttgtgataag
gttctggccagcagcatgactaaagaggagtgctgctgtacactgggagcaggatgggga
gacaactgtgaggtccatccctgccccataccgggaacagatcagttctcacagatgtgt
ccagcaggccggggttacctgatttctggagatcctatgagtactacctccagcttagca
gaaaacaccaaagcagatgcagatgaatgccagctctttggaagtgagatctgtaaagat
ggcttttgtctcaacaccgctggctggtatgagtgttattgcaaatctggactctactac
gatgagagcaaactacagtgtctcgacactgatgaatgccaagatgaggcaaaatgtaga
gatggtgaatgcatgaacacatatggctcatatcagtgtttctgcacccctcctatggtt
ctggcaatggacaacacacactgcatattacccgacgtagcagggcaaagtgaagctgac
ttatactcaggggtttgctgggagagagtaactgaaaacttctcctgcgcaaatcctatc
cccaacatacacacctcattcacagagtgctgctgtttgtatggagaggcctggggcaac
gattgtgctctctgccctgggaaaaatacagactcctatgcccaaatgtgtaatatccgt
cgaccgtatggtcgggatgctctggtcgctggcccaattggggtcagccctgattataac
cctcaacctctgaatcctgacggcacgcttccatacattgaagattacgatgaaccaaga
aatccatatgatgcatttgaaggactgcgagcagaggagtgcggtgtgctgaacggatgc
gagaacggtcggtgtgtgcgggtacaggagggatacacctgtgactgcttcgatggatac
acactcgacatgtcccgcatggcctgcgtggatatcaacgaatgctccgagctgaacgca
aagatgtctctttgcaagaacggcaactgcatcaacacacaaggctcttataagtgtgtg
tgccttccaggattcatcctctctgcccagcacaactactgcgtgccccacagacaaaat
gccaccagtacgggcacagagtga

DBGET integrated database retrieval system