KEGG   Danio rerio (zebrafish): 562442
Entry
562442            CDS       T01004                                 

Gene name
col8a1b
Definition
(RefSeq) collagen alpha-1(VIII) chain
  KO
K23455  collagen type VIII alpha
Organism
dre  Danio rerio (zebrafish)
SSDB
Motif
Pfam: Collagen C1q BclA_C
Other DBs
NCBI-GeneID: 562442
NCBI-ProteinID: XP_005161840
ZFIN: ZDB-GENE-060503-140
Ensembl: ENSDARG00000003533
Vega: OTTDARG00000018153
UniProt: X1WGI4
Position
22
AA seq 733 aa
MAGPLLSACLFVLVEHLCLLHHIHAGAFYGHKPLPQKRQPLPQLPLLPHGNEGITQHHYH
GKEIPQLPFGNEMPLLPQYGKERPQFPMHMGIPIARKGETVPRGQKGPPGEPGPIGLQGP
RGPPGLPGHGIPGPTGKPGPQGPPGLPGIGKPGMAGLPGKPGGIGLPGPKGELGPIGGEG
PIGLPGPPGLPGPHGLPGVAKPGGQGLPGQPGPRGEPGQKGFPGIPGLQGPKGENGFGLP
GLPGVKGLPGLPGPPGQVGLPGIGKPGLNGLPGVPGGQGKPGAPGEPGLAGVPGERGQIG
PPGLPGFGKPGLDGLPGKPGLPGGRGEPGQTGLTGGPGLPGFGKPGYPGPKGEKGHGGLP
GPIGPKGEKGHGGLPGMIGLQGPSGLPGPPGLMGPPGGIGFPGPKGEGGAVGPKGLLGPK
GEPGPQGLPGKPGFPGELGQPGPRGLTGPLGPKGESGHKGLPGLPGVPGKPGTKGELGFP
GEKGHPGPMGIPGLIGPAGPIGPPGLPGPKGEYGPPGKPGIPGEGKPGFPGPTGPAGIPG
PSGPHGPPGIPGPPGPPGLPGPRAQASFFGQILPETGPGLDGEKGGYKKEKPGGAIIGRH
GLEMPAFTAQLTTPFPQVGQPVVFNKILHNGNQNYNLQTGIFTCKIPGIYYFVYHVNCKG
NNVWVGLYRNNEPVMYTYDEYKKSYLDQASGSAVLPLNFGDTVHVQLPSEQAAGLYAGPY
VHSSFSGYLLYPM
NT seq 2202 nt   +upstreamnt  +downstreamnt
atggctgggcctctcctctctgcctgcttgtttgtactggtggagcatttgtgcctgcta
catcatatccatgcgggggcattttatggacacaaaccattgcctcaaaagcgccagcct
ctgccacagttacctcttctaccacatggcaatgaaggaataacacaacaccattaccat
ggaaaggaaatccctcaacttccctttggaaatgagatgcctttgcttccacagtatggg
aaggaacgtccacagtttcccatgcatatgggcataccgattgcaagaaaaggtgaaaca
gttccaagaggacagaaaggtcctcctggagagcccggtccgatagggcttcaagggcct
cggggccctccgggacttcctggtcatggtatcccagggcctacaggtaaacctggtcct
cagggcccaccaggccttcctggaattggaaagccaggtatggcaggtttgcccggaaaa
ccaggaggtataggtttaccagggccaaagggtgagttaggaccaattggtggtgaagga
ccaataggactaccaggacctccaggtcttccggggccacatggcttgccaggtgtggcg
aaaccagggggacaaggactccctggacaacctggccctcggggtgaacctggacaaaag
ggcttccctggcatccctggcctccaagggccaaaaggtgagaatggttttggtctccca
ggattgccaggcgtaaagggacttccaggattgcctggaccaccaggacaagttggacta
ccaggaattggcaaaccaggactgaatggactacctggggttcctggggggcaaggtaaa
cctggtgcacctggagaaccagggctagctggagtacctggggagagaggacaaattgga
ccaccgggattgccaggctttggcaaaccaggtttagatggcttaccagggaaaccaggt
ctaccaggtggaaggggcgagccaggtcaaacgggtttaactgggggtccaggcttgcct
ggatttggcaagcctggttatcctggccctaaaggtgaaaaagggcatggtggattgcct
gggccaataggcccaaaaggtgaaaaaggtcatggtggtctacctggaatgattggactg
caagggccaagtggcctcccaggtcctccaggtcttatgggaccccctggaggcattgga
tttcctggtccaaaaggagaaggtggtgcagtgggaccaaaaggactattgggtccaaaa
ggtgaaccaggacctcaaggtcttcctggcaagccaggattcccaggagaattggggcaa
ccaggacctagaggtttaactggtcccttaggaccaaaaggtgaaagtggacacaaaggc
ttacccgggctgcctggagtgcctggaaagcctggtacaaaaggagaacttggatttcca
ggtgagaaaggtcatccagggcctatgggaataccaggattaataggtccagcaggacca
ataggccctcctggtctacctggtccaaaaggagaatatggaccaccaggaaaacctgga
atcccaggtgaaggaaaaccaggatttccaggcccaacaggtcctgctggtatacctgga
ccgagtgggccccatggtccgcctggaatacctggtcctcctggcccacctgggctacct
ggacctcgtgctcaagcttcattttttgggcaaatacttcctgagacaggtcctgggctt
gatggggaaaaaggtggttataagaaagaaaagcctggaggagctattattggtaggcat
ggcctagaaatgcctgcatttacagctcagctgacaaccccatttccccaagttggacaa
cctgttgtcttcaacaaaattttgcataatggaaaccaaaattacaacttgcaaactggc
atcttcacatgcaaaatacctggaatttactactttgtctaccatgttaattgcaaagga
aacaatgtatgggtgggtttatacagaaacaatgagccagttatgtatacatatgatgaa
tacaagaaaagttacctggatcaggcatcagggagtgctgtactgcccttaaactttgga
gacactgttcacgttcagttaccatcagagcaagcagcaggactttatgctggtccttac
gtccactcatcattctctgggtatttgttatatcctatgtga

DBGET integrated database retrieval system