KEGG   Danio rerio (zebrafish): 562660
Entry
562660            CDS       T01004                                 

Gene name
commd9
Definition
(RefSeq) COMM domain-containing protein 9
  KO
K22565  COMM domain containing 9
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dre04121]
    562660 (commd9)
Ubiquitin system [BR:dre04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Multi subunit type E3 associated proteins
    562660 (commd9)
SSDB
Motif
Pfam: COMM_domain CM_1
Other DBs
NCBI-GeneID: 562660
NCBI-ProteinID: NP_001082867
ZFIN: ZDB-GENE-070424-139
Ensembl: ENSDARG00000094258
Vega: OTTDARG00000022764
UniProt: A4QN68
Position
17
AA seq 197 aa
MAFMTQDQFTALQLLLKAPSKDAVRQICTESFPAGAFKSQSVVEKTANALSVSHNEAVQL
LTAFHTLSHHIVYHNLTSPEQILSIFPESFHSNLKNLITKILLENSVKWRNEALANQISL
PKLVDMEWRVDMKTASDSLSRMAVPTCLLQMKLQDTPCISSGPSESTVTMELSKETLDTM
IDGLGRIRDQLSAVARK
NT seq 594 nt   +upstreamnt  +downstreamnt
atggctttcatgacacaagatcagttcactgctttgcaactgctgttaaaggctccgtct
aaagatgctgttcggcagatctgcacagagagtttcccagccggagccttcaagagtcag
tctgtagtggagaaaactgctaatgctctctctgtctctcacaatgaagcggttcagctg
ctgactgcatttcacacactttcacatcacattgtgtatcataacttaacatctccggag
cagatcctgtcaattttcccagaatcgttccactcaaacctaaagaacctgatcaccaaa
attctcttggagaacagtgtgaaatggagaaatgaagctttggcaaatcaaatttcgctg
ccaaagctggtggatatggagtggcgagtggacatgaaaactgcatcagactccctgagt
cgtatggctgtgccaacctgtctgttacaaatgaaactccaggatactccgtgcattagt
agtggtcccagtgagtctacagtaacaatggagctgagcaaagaaacgctggacactatg
atagacggtttgggtcgcatcagggatcagctctctgcagttgcaaggaagtag

DBGET integrated database retrieval system