KEGG   Danio rerio (zebrafish): 562992
Entry
562992            CDS       T01004                                 

Gene name
si:dkeyp-84f3.9
Definition
(RefSeq) gastrula zinc finger protein XlCGF48.2-like
Organism
dre  Danio rerio (zebrafish)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 Trm112p zf-C2H2_6 ATPase-cat_bd zf-C2H2_jaz DZR zf_UBZ
Other DBs
NCBI-GeneID: 562992
NCBI-ProteinID: XP_691447
ZFIN: ZDB-GENE-131127-66
Ensembl: ENSDARG00000097863
Vega: OTTDARG00000034356
UniProt: X1WC64
Position
16
AA seq 939 aa
MLEGEAKKHETNNGEAETQEQSVKSVGMGEFISKGLALSSQNREVEEPSPAATNVQPEPL
SCNADGKGSSEADVNTFPQPFSLVKNTNMDARRCSEDFDQPEANSDCVSSTTDSQPKSLP
TNTELNKPQTSTQVSDKTDEISSNQPERESDMNEALYANVLTPAEADYDASSSNKGDSNY
SDKDIHESTADPMVSDVEMQDSLSETLNQNDETLDDEDPSTEEQQESNSEQNKETPAEDD
NAKENSMEVTENKHGFPSFTRGRPRKEKRVIRCEHCSRPFNHASAYIIHLRIHTGEKPFV
CQDCGKAFAQLSNLRSHSKVHRSRSRKHRNQNKVTTEKSADESQVYSTDKKETDFHSNQI
TSKRRRGRGKGKGKPQTCPICAKVFCYKSVLKIHLRIHSGEKPYSCKVCGKSFTQACTAR
VHERVHWSIRPFLCTKCGKGFSQLGPLKLHTCEGKTRMHNTVKEMETDGVVSFRCHLCKT
CFSTRDEYELHVQGHKDTQRYSCDRCKQTFSLLSELHTHSKHCGAIRLAKSKFSGYSPPH
RSQPKSPMNRRTPPRVRSPAKSPQKEIFSPRKLKRCSLLACPPQILAASDSDFPNNLYSV
SQPIKSSYFVSQLNSTHHKADPRSYFCPRCGRIFRHVGRLRAHMLTHSRGKNFTCVYCNR
VFKTWNKFWIHQRLHRQIRGRFFCPKCGRGFRFVESYNEHVQKHPELNAHACPFCTRTFS
NAQKLRNHQEKWHHSTMPFVCEYCGKGFESATILKRHKVVHCTIDPIETLYNADLQSTGH
PYECGACSACFGNLDLLFHHQLQHKAADKEPTAMKGFQRQSSVSHSNGAERPHSVSPLRS
SPLKKPQQNPNQSPSTIKTLPQLSTNHQTLPGSKTNEEQMLENHTKNRVPVTAESNNSNK
SVLKTESTTGNLVCTECNACFSDLVALHGHYLEHARGEI
NT seq 2820 nt   +upstreamnt  +downstreamnt
atgcttgaaggagaagctaagaagcatgaaaccaacaacggtgaagctgaaacccaggaa
cagtctgtgaagagtgtgggaatgggggaattcatttcaaaaggtctggcgttaagctcc
cagaacagagaagtggaggaaccttcaccagcagccactaatgtccaacctgaacccttg
tcctgtaatgctgatgggaaaggctccagtgaagcagatgtaaatacatttccacaaccg
tttagtctagttaagaatactaatatggatgctcggagatgctcagaagactttgatcag
ccggaggctaattctgattgtgtttccagcaccacagatagccaaccaaaatcattgcca
actaatacagaattaaataaaccacaaactagcactcaggtgtctgataaaacagatgaa
atctcgagtaatcagcctgaaagggagtctgacatgaatgaagccctttatgcaaatgtg
ctaacccctgcggaagctgattatgatgcatccagctctaataaaggtgatagcaattat
tctgacaaagacattcacgagagcactgcagatccaatggtttctgatgttgaaatgcaa
gattcgctctctgaaacattaaaccaaaatgatgaaacattagatgatgaagatccttca
actgaggaacaacaagagtctaattcagagcagaataaagagactcctgcagaagatgac
aacgctaaggaaaatagtatggaggttacagaaaacaaacacggatttccttcttttacc
cgcggacggcctcgcaaagaaaagcgagttatcagatgtgaacattgctcacgtccgttc
aaccatgcctctgcgtatatcattcatctgcgcatccacaccggtgagaagccctttgtt
tgccaggactgcggcaaagccttcgctcaactctccaaccttagatcccacagcaaagtc
catagatccagaagccggaaacacagaaatcaaaacaaagtcacaactgagaaatctgca
gacgagagtcaagtgtacagtactgataaaaaagaaactgactttcatagcaatcaaatc
acttctaaaagaaggagaggccgagggaaaggaaaagggaaaccccaaacatgtccaatt
tgtgcaaaggtcttctgctacaagtccgtcctcaaaatccatcttcgcattcacagtgga
gaaaaaccgtactcttgtaaggtgtgtggcaaatcgtttactcaggcctgcaccgcgcgt
gttcatgaacgagtgcactggtccattaggcctttcctgtgcaccaaatgtggtaaagga
ttttctcagctcgggccgttaaaattacatacttgtgaaggaaaaacacgcatgcataac
actgtgaaagaaatggaaaccgacggcgttgtcagcttcaggtgccacctttgcaaaaca
tgcttcagcaccagggatgagtatgaattacatgtgcaagggcacaaggatactcagcgt
tacagttgtgaccgatgcaagcagactttcagtcttctctcagagctgcatacgcacagc
aagcattgtggtgccatacgacttgcaaaatcaaagttttctggctacagtccacctcac
agatcacaacccaaaagcccaatgaacagaagaactccaccgagagtgcgcagtccagca
aaatctcctcaaaaagagattttctcgccaagaaagctcaaaaggtgctccttgcttgct
tgtcctcctcaaatcttggctgcttcagattcagactttccgaataacctttattcagtc
agtcagccgatcaagtctagctattttgtatcccagttgaacagtacgcaccataaagca
gatccaaggagttacttctgcccacgatgtggacgaatattccggcacgtgggaagactg
agagcacatatgctgacgcattcgcgtggtaaaaacttcacatgtgtctattgcaacagg
gtgtttaagacctggaacaagttttggattcatcagcggctgcatagacaaattagaggc
cgttttttttgtcccaaatgcggtcgggggtttcgatttgtggaatcgtacaatgaacat
gtgcagaagcacccggagcttaatgctcacgcttgtcctttctgcactcgtactttctca
aatgcacagaagttgaggaatcaccaggaaaagtggcaccattccaccatgccctttgtt
tgtgagtattgcggaaaaggattcgaaagtgcgaccattcttaagcgacacaaagttgtt
cactgcacaattgatccaatcgagacactttacaacgctgatctgcagtccactggacat
ccctatgagtgcggggcatgcagtgcctgttttgggaatttggatttgcttttccaccat
cagctccagcacaaggctgcagataaagaaccaacagcaatgaagggctttcagcgtcag
agctcagtctcacattcaaatggtgcagaaaggcctcattctgtgtcacccttacgttca
tcacccttaaaaaagccacagcaaaatccaaaccagtctccgagcaccatcaagacattg
cctcaactgtcaacaaatcatcaaactttacctggctccaaaactaacgaggagcaaatg
cttgaaaatcacactaaaaaccgagttccggtgacggcagaatcaaataattctaacaag
tccgttttgaagactgaaagtaccactggtaatttagtttgcactgaatgcaatgcttgt
ttttcagatcttgtagcgctgcatgggcattacttggaacatgccagaggagaaatataa

DBGET integrated database retrieval system