KEGG   Danio rerio (zebrafish): 562996Help
Entry
562996            CDS       T01004                                 

Gene name
dnase2b
Definition
(RefSeq) deoxyribonuclease-2-beta isoform X2
  KO
K01158  deoxyribonuclease II [EC:3.1.22.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04142  Lysosome
Brite
KEGG Orthology (KO) [BR:dre00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    562996 (dnase2b)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.1  deoxyribonuclease II
     562996 (dnase2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNase_II Spore_GerQ
Motif
Other DBs
NCBI-GeneID: 562996
NCBI-ProteinID: XP_009304118
ZFIN: ZDB-GENE-090824-2
Ensembl: ENSDARG00000077918
Vega: OTTDARG00000042121
Position
11
AA seq 251 aa AA seqDB search
MLYNDAPPELKYPSKYGHTKGVLMFDQDQGFWLTHSVPHFPPFPERNYSYPLTGKYYGQT
LLCITFNYTQFPRISWQLAYLNPRVYNCSVPVAFRPDIGEMAQICDGKTPAIKNRRSLQK
LQSVQGQTFFSFAKSQNYVDDIYTGWVAQALGTDLLVESWLHQAHQLPSNCSLPWHVMNI
NAVCLPGPQMFRSYEDHSKWCVSYTFKDQWTCLGDLNRDGGQAGRGGGLTCCQNSVIYKA
FRKAMARYKHC
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgctttacaatgatgctccaccagaactgaagtacccaagcaagtacggacatacaaaa
ggggtgctgatgttcgaccaggatcagggattctggctcacacacagtgttcctcatttt
cctccgttcccagaaagaaactacagctaccctctcacaggaaaatactacggacagact
ttgctctgcattacattcaactatacacaattccctcgtatatcatggcagttagcgtat
ctaaatccacgtgtgtataattgctctgtccctgtggcgtttcgccccgatattggagaa
atggcacaaatttgtgatggaaagacacctgccataaaaaacaggaggagtttgcaaaag
ctgcagtcagttcaaggacagacgtttttcagttttgccaaatcacagaactatgtggat
gatatttacacaggctgggttgctcaagcactagggacagatctactggtggaatcatgg
cttcaccaggctcatcaactcccctctaactgctccctaccctggcacgtgatgaacatt
aacgcggtctgtctacccggacctcagatgttcagaagctatgaggatcattctaagtgg
tgtgtgtcttacacttttaaagaccagtggacatgcctgggggacttgaacagagatggt
ggtcaggctggcagaggtggagggttaacatgttgtcaaaactcagttatttataaagct
ttccgtaaggccatggccagatataaacactgctga

DBGET integrated database retrieval system