KEGG   Danio rerio (zebrafish): 563212Help
Entry
563212            CDS       T01004                                 

Gene name
chaf1a
Definition
(RefSeq) chromatin assembly factor 1 subunit A
  KO
K10750  chromatin assembly factor 1 subunit A
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dre03036]
    563212 (chaf1a)
Chromosome and associated proteins [BR:dre03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histone chaperones
    CAF-1
     563212 (chaf1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CAF1-p150_C2 CAF-1_p150 CAF1A CAF1-p150_N
Motif
Other DBs
NCBI-GeneID: 563212
NCBI-ProteinID: NP_001038478
ZFIN: ZDB-GENE-030131-5366
Ensembl: ENSDARG00000062152
Vega: OTTDARG00000010608
UniProt: A0JMK9 B2GSW9
Position
22
AA seq 863 aa AA seqDB search
MVVVMLAAEEPLASTPRRDMDCVGKANTNKKLVQARLPFKRLNPEPKECNEPKRTKGPVA
PKCSEPSDQENDQDSSSISHHGPALVNGRGPLDCFMSRRKRSPLRSAPEATIDLTEDSND
SAKQQPAPPIAATCPLSEEKTKTSEGTTEPTIPLTEEETEKDEAEDVDALPLLDITQDSD
TEEEEEEEEEEEEQQQEAEVSHGNESVLSTGSTSSASVIASSPEPSKSAPTTPASTSRIN
AANKVKRRSLKSVQEQEEKQRQRDEKERLKQEAKAAKEKKKEEARKMKEEKEREKKEKKE
KDEKERREKKERDEKEKADKLKAKEEQRQMKIEAKLEEKRKKEEEKRLKEEKDRIKAEKA
EITRFLQKPKTQLAPKTLASACGKFAPFEIKAHMSLAPLTRVQCEDSVLEDLDRYLAQPD
STLNGLKDWTGHKPRSSGPTRPRHSAQGDCVVITESQKADDGPDRSRYGRMKLLHFHDNY
RPAYWGTWSKKSTHISPRCPLRLDKDLLDYEVDSDEEWEEEEPGESLSHSEGDDDDEAGE
DDDDDDGFFVPHGYLSEGEGALEDEEGGDPEKQKVRQRMKAREWENELMSKGKVKVLEAV
VRGCFWEGEKPLPDFLQPYAVCMLEPLSKDEASTPEQDASRQQRNEKLLTMLLPLLHGNV
NSNKVIITEFLEFCRQQTSSPTESLLNTTESIPPRIHVRRIIKENAVYEKRSTFKRCCWY
VHADVLARYSQEALPVPCQWSYLTSGANVTRDEHSGSQGNSPTTNSSTTPSNKRKSASSH
SITKYMKKCGESEQTEAMETDGFQADTEDDEDDDCIIIGEQSGSSEQDINTSLPQTDRET
EPMDTSASETAALALPCPTPATA
NT seq 2592 nt NT seq  +upstreamnt  +downstreamnt
atggtggtcgtgatgctcgcggccgaagagcctttggcctccactccacgcagagatatg
gattgtgtgggcaaagctaataccaacaagaagcttgttcaagcacgtctgcctttcaaa
aggctcaaccctgaacccaaggaatgcaatgagcccaaaagaaccaaaggtcccgttgct
cccaagtgttctgaacccagtgatcaggaaaatgatcaggacagctcctccatctcgcac
catggcccggctctggtgaacggccgtggtcctcttgattgcttcatgagtcggcggaag
cgttccccgctccgctcagcccctgaagccactatcgacctaactgaagactcaaacgat
tctgccaaacagcagccggcacctcctatcgctgccacctgccctcttagtgaagagaaa
acaaagacctctgaaggtactacagaaccgactataccactgacagaggaggagactgaa
aaggatgaagctgaagatgtagatgccctcccgcttctggacatcactcaggactctgac
actgaggaggaggaggaggaggaggaggaggaagaggagcagcagcaggaggctgaagtc
agtcatgggaatgagtctgtgctgtccacagggtccaccagctccgcctctgtgatcgcg
agctcaccagagcccagcaaaagtgctcccaccacccctgcttctacatcacggataaat
gcagctaataaagtgaagagacgatcccttaagagtgttcaagagcaggaggagaagcag
cgacagagggatgagaaagaacggctgaaacaggaggccaaagctgccaaggagaagaag
aaagaggaggcccgcaagatgaaggaggagaaggagagggagaaaaaagagaaaaaggag
aaagatgaaaaggagcggcgggaaaaaaaggagagggacgaaaaagaaaaagcagataaa
ttaaaagctaaagaagagcaacggcagatgaaaattgaggccaaactagaagagaaaagg
aagaaagaagaggaaaaacggttaaaggaagagaaagatcgaattaaagctgagaaggct
gagattacacggtttctgcaaaagcccaagacccagttggcaccaaagactctggcttct
gcctgcgggaagtttgctccgtttgagatcaaagcacacatgtctctggcaccgctaact
cgagtacaatgtgaagactctgtgctagaggacctggaccgctatcttgcccaacccgac
agtactctgaatggactgaaggactggacagggcacaaacctcgcagttcaggtcccacc
agacccaggcatagtgcacaaggagactgtgtggtcataactgagagccagaaggcagat
gatggaccagaccgcagtcgttacggccgcatgaagctcctgcatttccatgacaactat
cggccagcttattggggaacctggagcaaaaaaagcacccacatctcgccacgctgcccg
ttgaggctggacaaggatctgctggattatgaggtggacagtgatgaagagtgggaggag
gaggagccaggagagtctctgtcacacagtgagggggatgacgatgacgaagcaggagag
gacgacgatgatgatgatgggttttttgtgccccatggttatctctcagaaggggaagga
gcacttgaagatgaggagggtggagacccagagaagcagaaggtgcgtcagaggatgaag
gctcgtgaatgggagaatgagctgatgtctaaagggaaggtgaaggttttggaggctgtg
gtacgcggctgcttttgggaaggagaaaagcccttgcctgacttcctgcaaccatacgct
gtctgcatgctggagcctttatctaaagatgaggcctccacccctgaacaagacgcctca
cgccagcagaggaacgagaaactgcttacaatgctgctgccattgctgcatgggaatgtg
aatagcaataaggtgataatcaccgagttcctcgagttttgtcgccaacaaacctcctcg
cccacagaaagccttctcaatacgacagagagcattccacccaggatccatgtcaggcgt
atcatcaaggagaacgccgtgtatgaaaagcgctccacatttaaacgctgctgctggtac
gtgcatgcagatgttctggcccgttactctcaggaggctttacccgttccctgccagtgg
agctacctcacctctggggcaaatgtcacccgcgatgagcatagcggctcacagggcaat
tcgcccaccacaaactcttctaccacaccctccaacaagaggaaaagcgccagcagccac
tccatcaccaagtatatgaagaaatgtggtgaatctgaacagactgaggccatggagaca
gatggcttccaggcagatacagaggatgatgaagacgatgattgtatcatcattggagag
caatctggatcctctgaacaggacatcaacacatccttgccacaaacagatcgagaaaca
gagcccatggacacgagtgcatctgaaactgctgctctcgccttgccctgtcccacccct
gccaccgcctga

DBGET integrated database retrieval system