KEGG   Danio rerio (zebrafish): 563253
Entry
563253            CDS       T01004                                 

Gene name
si:ch211-198a12.6
Definition
(RefSeq) uncharacterized protein LOC563253
Organism
dre  Danio rerio (zebrafish)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_11 zf-C2H2_jaz Zn-ribbon_8 C1_1 zinc_ribbon_15 zf_UBZ zf-C2H2_6 zf-trcl zf-C2HE zf-LYAR
Other DBs
NCBI-GeneID: 563253
NCBI-ProteinID: NP_001139051
ZFIN: ZDB-GENE-030131-1683
Ensembl: ENSDARG00000074624
Vega: OTTDARG00000029577
UniProt: B8A688
Position
13
AA seq 524 aa
MAESETDCDTPGLDTLGSECVIAHTQVGDLHYGAETEIMTQEDKRLDLEAIHGDLGAVTC
VDVVTETDHDYIKSEIHHDHHQYFSSAEIKGNEHLLGEVLLKTEIGGGDHIVKVESDHGG
ELTVESENGVIIHEAHGLQCSECGEIFGCMSDLHEHFEIHKATHPYICVHCGESFAIEAS
LRSHMRIHMKEKSYTTGLEMVGKGVIDAFSLKPHQMMHSPEKPHRCSECGKSFAAAITLR
EHMKMHSDDKPYKCTQCRKSFMRRRHLKKHQELHARDKPFTCLQCGKGFTTASNLKQHQK
THAGDKPHRCTQCGKCFAAAATLREHQRIHSGEKPYKCTQCRKSFVRKRHLKKHQLVHQG
GKPYRCSQCDKGFNHSSSLSRHHKVHLEAKMYAQADKDFPFDTTLKRGMHTGEKPYSCNH
CEKSFNHSSSLSRHQRTHSDGKSYTCAQCGKRFNHPSSLARHQRVHLEDKSTYSAIATGK
GFPHTTILKQRILQSEKPYRCAQCGKGFNHSSSLSRHHRIHIDQ
NT seq 1575 nt   +upstreamnt  +downstreamnt
atggctgagtcagagactgactgtgacacaccaggtctcgatacgttgggatctgagtgt
gtcatagcccatacgcaagttggggacttgcattatggggcagagacagagattatgact
caagaggacaaaagacttgacctggaggccattcatggtgatttaggagcagtaacctgc
gtggatgtagttacagagacggaccatgactacattaaatcagaaatacaccacgatcat
caccagtacttcagcagtgcagaaataaaaggcaatgagcatttgcttggggaggtgctg
ttgaagaccgagataggtggcggagatcatatcgtaaaggtggagtctgaccacggaggg
gagctaacggtggagtctgagaatggtgttatcatccatgaggctcatggcctgcagtgc
agcgagtgtggcgagatatttggctgtatgtcagatctgcacgaacactttgaaattcac
aaagccactcacccttacatttgcgtccactgtggggagagctttgctattgaagccagc
ctaagaagtcacatgagaattcacatgaaagagaaaagttataccactggtcttgagatg
gttggcaaaggagtaattgatgcattcagtttgaaaccgcaccagatgatgcattctcct
gagaagccacatagatgttcagagtgtggcaaaagctttgccgctgccatcactttgcgg
gagcacatgaaaatgcattcagatgacaaaccctacaagtgcacccaatgccgaaaaagc
tttatgcgcagacgtcatctcaaaaaacaccaagagctgcatgcccgtgacaagccgttc
acctgtcttcagtgtggtaaaggctttacgactgcttccaatcttaaacagcaccagaag
acccatgctggggataagccacaccgatgcacccagtgtggaaagtgttttgcggcagct
gccacgctgagagagcaccagagaatccactcgggggagaagccctacaagtgcacccag
tgtcggaagagctttgtgagaaaacgccacctcaagaagcatcagctggttcatcagggt
ggaaagccgtaccgttgttctcagtgtgacaagggttttaaccattcctcttccttgtca
agacaccacaaggtccacttggaggccaagatgtacgcccaggctgataaagatttccct
tttgatactacactgaagaggggaatgcatactggcgaaaagccatacagctgcaaccat
tgcgagaagagcttcaatcactcgtcctcactatccaggcaccagagaactcattctgat
ggaaagtcttacacctgtgctcagtgtggtaaaagattcaaccacccctcctcgctcgca
aggcaccaacgggttcatttggaggataagtcaacttatagtgctattgcaacaggaaag
ggtttcccccacactaccatcttgaaacagagaatccttcagagtgagaaaccatacaga
tgcgctcagtgtggaaagggattcaatcattcgtcttctctgtctaggcatcacagaatt
catattgatcagtaa

DBGET integrated database retrieval system