KEGG   Danio rerio (zebrafish): 563286
Entry
563286            CDS       T01004                                 

Gene name
mhc2d8.35b2
Definition
(RefSeq) uncharacterized protein LOC563286
Organism
dre  Danio rerio (zebrafish)
Motif
Pfam: C1-set MHC_II_beta C2-set_2 Ig_3 Ig_mannosidase
Other DBs
NCBI-GeneID: 563286
NCBI-ProteinID: NP_001074102
ZFIN: ZDB-GENE-030616-171
Ensembl: ENSDARG00000104730
Vega: OTTDARG00000036904
UniProt: A0A0R4IRA8
Position
8
AA seq 277 aa
MFSSIHFVFSVAKMSQKKLYSSLILILALFFVGESANVYYMYRVSRCIFSSSNISAMVYF
DRTYFNKNLFIQFNSNLGRFEGFNEYGLKLAEFWNNGTFVDQEKDVVEFFCKYNSQIYEN
SILDKAVKPKVKLSSVTRAGGRQSTVLMCSAYDFYPPHINVFWLRNGEVMTSEVTSTMEM
ADGDWYYQIHSELEYSPKPGERISCVIEHASSNKPMIYDWDPSLPVFERNKISIGVSALV
LGIITAAAGIIYYKKKTTGRTSVVPSRLITLPLMFGR
NT seq 834 nt   +upstreamnt  +downstreamnt
atgttcagcagcattcactttgtattcagcgtggctaaaatgtcacagaaaaagctctat
agttctctcatattgattttggctctattctttgtaggggaaagtgctaatgtatattac
atgtaccgtgtatcaagatgcatcttcagctcctctaatatcagtgccatggtgtatttt
gaccgcacgtatttcaataaaaatctattcatacagtttaacagcaatctggggaggttt
gaagggtttaacgagtatggattaaaacttgcagagttctggaacaatggaacatttgta
gatcaggagaaagacgttgtggaatttttctgcaagtataattctcaaatctatgaaaac
agcatcttagataaagcagtgaaaccaaaggttaagcttagttcagtgacccgggccggt
ggaagacaatcaacagttttgatgtgcagcgcatatgatttttatcctccacacatcaac
gtgttctggttgagaaatggtgaagtaatgacctctgaagtgacctcaactatggagatg
gctgatggtgactggtattaccagattcactctgagcttgaatacagtccgaaacctgga
gaaaggatttcctgtgtgattgaacatgccagctctaacaaacccatgatttatgactgg
gatccatctcttcctgtctttgagaggaataaaatttccatcggggtttctgctcttgtg
ctgggaatcatcactgcagcagctggaatcatttactacaagaagaaaactacagggagg
acttcagtagttccaagtcgcctgattacattgccacttatgttcggacgctaa

DBGET integrated database retrieval system