KEGG   Danio rerio (zebrafish): 563490
Entry
563490            CDS       T01004                                 

Gene name
si:dkey-23a13.8
Definition
(RefSeq) histone H2B 1/2-like
  KO
K11252  histone H2B
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dre03036]
    563490 (si:dkey-23a13.8)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dre04147]
    563490 (si:dkey-23a13.8)
Chromosome and associated proteins [BR:dre03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    563490 (si:dkey-23a13.8)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   563490 (si:dkey-23a13.8)
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like
Other DBs
NCBI-GeneID: 563490
NCBI-ProteinID: XP_691943
ZFIN: ZDB-GENE-160113-110
Vega: OTTDARG00000043444
UniProt: R4GE15
Position
7
AA seq 161 aa
MHQSEGWLFLLKSAQGPNKFLCLTRIVDRTYYLLHSNMPEPAKPAPKKGSKKAVTKTAGK
GGKKRKRTRKESYAIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYN
KRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
NT seq 486 nt   +upstreamnt  +downstreamnt
atgcaccaatcagaaggctggttattccttctgaaatctgcacaagggcctaataaattc
ttatgtctcacccgtatagttgacagaacatattaccttctccattcgaatatgccagaa
ccagcgaagcccgcacccaagaaaggctccaagaaggcggttactaaaaccgctggtaaa
ggaggaaagaagcgcaagaggaccaggaaggagagctatgctatctacgtgtacaaagtg
ctgaagcaggttcatcctgacactggtatctcctctaaagcgatgggcattatgaattcg
ttcgtcaacgacatcttcgagcgcatcgccggtgaggcttctcgtctcgctcactacaac
aagcgctccaccatcacatcaagagagatccagaccgccgtgcgtctgctgctgcccgga
gagctggccaaacacgccgtgtctgagggcacaaaggccgtcaccaagtacaccagctcc
aagtaa

DBGET integrated database retrieval system