KEGG   Danio rerio (zebrafish): 563569
Entry
563569            CDS       T01004                                 

Gene name
si:dkey-261m9.6
Definition
(RefSeq) histone H2B 1/2-like
  KO
K11252  histone H2B
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dre03036]
    563569 (si:dkey-261m9.6)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dre04147]
    563569 (si:dkey-261m9.6)
Chromosome and associated proteins [BR:dre03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    563569 (si:dkey-261m9.6)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   563569 (si:dkey-261m9.6)
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like
Other DBs
NCBI-GeneID: 563569
NCBI-ProteinID: XP_005163278
ZFIN: ZDB-GENE-131127-103
Ensembl: ENSDARG00000116654
Vega: OTTDARG00000039545
UniProt: X1WHF1
Position
25
AA seq 124 aa
MPEPAKPAPKKGSKKAVTKTAGKGGKKRKRTRKESYAIYVYKVLKQVHPDTGISSKAMGI
MNSFVNDIFERIAGEASRLAHYNKRSTISSREIQTAVRLLLPGELAKHAVSEGTKAVTKY
TSSK
NT seq 375 nt   +upstreamnt  +downstreamnt
atgcctgaaccagcgaagccagcgcccaagaagggctccaagaaagcggtaaccaagacc
gctggtaaaggaggaaagaagcgcaagaggaccaggaaggagagctatgctatctatgtt
tacaaggtattgaagcaggttcatcctgataccggaatttcctcaaaggcgatgggcatc
atgaactcgttcgtcaacgacatcttcgagcgcatcgccggtgaggcgtctcgtctcgct
cactacaacaagcgctccaccatctcatctagggagatccagaccgccgtgcgtctgttg
ctgcccggagagctggccaaacacgccgtgtccgagggcacaaaggccgtcacaaagtac
accagctccaagtaa

DBGET integrated database retrieval system