KEGG   Danio rerio (zebrafish): 564068
Entry
564068            CDS       T01004                                 

Gene name
erap1a
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1 isoform X2
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dre01002]
    564068 (erap1a)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     564068 (erap1a)
Peptidases and inhibitors [BR:dre01002]
 Metallo peptidases
  Family M1
   564068 (erap1a)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 564068
NCBI-ProteinID: XP_005155590
ZFIN: ZDB-GENE-091113-7
Ensembl: ENSDARG00000013024
Vega: OTTDARG00000030823
Position
10
AA seq 932 aa
MLFLAKYFHFTLVALFCALFAGNHAMTVNKNKTVLPFPWDKMRLPEIVKPQHYDLLIHPN
LTSLTFTGEVQIQIEVKQDTRAIILHSKNLQVSKALLLGSRQHHHHQDLQISEFEANEQI
ALFSEGFTFEKGSHVVHLEFYANLSDSFHGFYKGQYTTNSGEVRMLASTQFEPTHARAAF
PCFDEPAFKANFTIRVRRESRHISISNMPKLRTVELADGILEDQFDTMVKMSTYLVAFII
CDFHSISKKSQHGVEISVYTVPEKISQAEYALDTAVTMLDFYDEYFDIPYPLPKHDLAAI
PDFQSGAMENWGLSTYRESGLLFDPEKSSSSDKLGITKVIAHELAHQWFGNLVTMQWWND
LWLNEGFAKFMEYVSVNITHPELQVNDYFLEKCFTALSVDSLSSSHPVSTPVENPAEISE
MFDDVSYRKGACILNMLRDFLTPEVFKYGIINYLKKHSYQNTVNSHLWESLTNICTSDGL
DSGRLKLDGFCSKHTAETPASWFKEDSVDVGAIMDTWTLQEGFPLITVEVKGQEVTLKQE
RFLKGAESSNSSSFLWQVPLTYITSGSNAVQRFLLKTERDVFYLPEKVEWIKFNVDLRGY
YIVHYESGGWDCLIKQLRMNHTVFSSNDRASLIHDIFQLVSIEKVPLDKALNLSLYLSKE
SEIMPVTQGFSELVPLYKLMEKRDMQELENQLKSHLVKLFQPLIDRQSWSDNGSVSERML
RNYLLLFACVRRYPSCVSTATQLFHKWKESDGKMWLPTDVSLVVYTEGARTDDGWDFLLE
KYKRSVSPSEKWMIKAALSYSPLAHKLQWLLERSSEGEIMKTQDLPSMLISVSKNPKGFK
LAWDFLKSNWGKLVKKFDLGSSAISRVVVGVTDQYSTKEMLDEVELFFGSLAQDQGSGLR
SIQQALEKIQQNILWMDRNVPLLKAWLDHHTS
NT seq 2799 nt   +upstreamnt  +downstreamnt
atgctattcttagcaaagtattttcattttacattagtagctttgttctgtgctcttttt
gctggcaaccatgccatgaccgtcaacaagaacaaaaccgtgctgcctttcccctgggat
aagatgaggttgccagaaattgtcaaaccccagcattatgacctcctcattcaccccaac
ttgacctctctgacgtttactggagaggttcagatccaaatagaggtaaaacaggacacg
agggcaatcatcctccacagcaagaacctacaggtctccaaagctcttcttttgggctcc
agacaacatcatcatcatcaggatcttcagatcagtgagtttgaagccaatgaacagatt
gcactcttctctgaaggcttcactttcgagaaagggagccatgtggtgcatttggagttc
tacgccaacttatctgacagcttccatggcttttataaaggccagtacactacaaatagt
ggggaggttaggatgttggcgtccactcagtttgagccgacacatgcccgagctgccttt
ccttgttttgatgagcctgcattcaaagccaactttaccatccgcgtgcgcagagaatca
aggcacatatccatatcaaacatgcccaagctgagaactgtagagctggctgacgggatt
ctggaggatcaatttgacaccatggtaaagatgagcacctacctggtggccttcatcatc
tgcgacttccactccatcagtaaaaaaagtcagcacggagttgagatatcagtgtataca
gttcccgagaagatcagtcaagcggagtatgccctcgacaccgccgtcacaatgctcgac
ttttatgatgagtattttgacatcccgtatccgcttcccaaacacgatctcgcagccatc
ccagatttccagtcgggtgctatggagaactggggtctgtcgacgtacagagagtccggt
ttgctctttgaccctgagaaatcttcttcctctgacaaattaggcatcaccaaagtcatc
gctcacgaactagcccatcagtggtttggaaacctggtcacaatgcagtggtggaacgac
ctgtggttaaacgagggctttgccaagttcatggagtatgtgtcggtcaacatcactcac
cctgagctgcaagtgaatgattatttcctggagaaatgcttcactgccttatccgtggac
tctctgagctcctcgcaccctgtttccactccagtagagaatcctgcagagatcagcgag
atgtttgatgacgtctcctatcgaaagggtgcgtgtatcctgaatatgctgagggatttt
ctgactccagaggtgttcaagtacggtattataaactacctgaagaaacacagctaccag
aacacagtcaactcgcacctctgggagagccttaccaatatctgcacttcagatggattg
gattcagggagactaaaacttgacggattctgctccaaacacacggctgaaacgccagcc
tcttggttcaaggaggacagtgttgacgttggagccatcatggacacctggactctgcag
gagggctttcctttaatcactgtggaggtcaaaggtcaagaggtcactcttaaacaggag
cgcttcctgaaaggagcagaatcgtcaaattcatcaagcttcctgtggcaggttcctctg
acgtacatcaccagcggcagtaatgcagtgcagcgtttcttgctgaaaaccgaaagagat
gtgttttacctgccagagaaggtggagtggattaaatttaacgtggatctgcgaggatat
tatattgtgcattatgagtctggaggctgggattgcttgattaagcagctccgaatgaac
cacactgtgttcagcagcaacgacagagccagtctcatacatgacatcttccagctggtc
agcattgagaaggtccctctggataaagctctgaatctgagtttgtatctcagtaaagag
tccgagatcatgccggtgacgcagggcttcagtgaactggtgccgctttacaaactcatg
gagaagagagacatgcaggaactggagaaccagctcaagagtcatttagtgaagttattc
cagccactgattgaccggcagagctggtctgataatgggtctgtgtccgagcggatgctc
aggaattatctgctgctgttcgcgtgtgtccgccgctacccgtcctgcgtcagcaccgcc
acacagctgtttcacaagtggaaggaatctgatggcaaaatgtggcttcctaccgacgtc
agtttggtggtctacactgaaggggcgcgaacagacgacggctgggactttttgttagag
aaatacaagcgatccgtctctccatcagagaagtggatgattaaagctgccctctcgtac
agtccactagctcacaaacttcagtggcttttggaaagaagcagtgaaggagagatcatg
aaaactcaagacctgccgtcgatgcttatcagcgtcagtaaaaaccccaaaggcttcaaa
ctggcctgggacttcctgaaaagcaactgggggaaactggtgaaaaagtttgatctcggc
tcttctgctatatctcgcgtggtggtcggagtcaccgatcagtattccaccaaagaaatg
cttgatgaggtagagttgttctttgggtcactggcgcaggatcagggctccgggctccgc
agtatccaacaggccctggagaaaatccagcagaacatcctctggatggacaggaacgtc
ccactgctgaaagcctggctggaccatcacacttcatga

DBGET integrated database retrieval system