KEGG   Danio rerio (zebrafish): 564337Help
Entry
564337            CDS       T01004                                 

Gene name
ppp3r1a
Definition
(RefSeq) calcineurin subunit B type 1
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04020  Calcium signaling pathway
dre04114  Oocyte meiosis
dre04218  Cellular senescence
dre04310  Wnt signaling pathway
dre04370  VEGF signaling pathway
dre04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    564337 (ppp3r1a)
   04310 Wnt signaling pathway
    564337 (ppp3r1a)
   04370 VEGF signaling pathway
    564337 (ppp3r1a)
   04020 Calcium signaling pathway
    564337 (ppp3r1a)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    564337 (ppp3r1a)
   04218 Cellular senescence
    564337 (ppp3r1a)
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    564337 (ppp3r1a)
Protein phosphatases and associated proteins [BR:dre01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     564337 (ppp3r1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Motif
Other DBs
NCBI-GeneID: 564337
NCBI-ProteinID: NP_001314701
ZFIN: ZDB-GENE-081113-3
Ensembl: ENSDARG00000092659
Vega: OTTDARG00000029341
UniProt: E9QG20
Position
13
AA seq 170 aa AA seqDB search
MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID
IFDTDGNGEVDFKEFIEGVSQFSVKGDKEMKLRFAFRIYDMDKDGYISNGELFQVLKMMV
GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatgaggcaagttatcccctggaaatgtgctcgcatttcgatgctgatgagatt
aaacggctgggaaagaggtttaagaaactcgacctggataattcaggatctctgagcgtg
gaggagttcatgtccttgcccgagttgcagcagaatccgctggtgcagagagtcatcgac
atattcgacaccgacgggaacggagaggtggatttcaaagagttcatcgaaggcgtctct
cagttcagtgtgaagggagataaagagatgaaactgcgcttcgcctttaggatctacgac
atggacaaagacggctatatttccaacggcgagctgttccaggtgctgaagatgatggtg
ggcaacaacctgaaggacacgcaactgcagcagatcgtggataaaaccatcatcaacgca
gacaaagacggagacgggagaatatccttcgaggagttctgcgccgttgttggaggtctg
gatatacacaagaagatggttgtggacgtgtga

DBGET integrated database retrieval system