KEGG   Danio rerio (zebrafish): 564874Help
Entry
564874            CDS       T01004                                 

Gene name
tnfrsf21
Definition
(RefSeq) tumor necrosis factor receptor superfamily member 21 precursor
  KO
K05157  tumor necrosis factor receptor superfamily member 21
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    564874 (tnfrsf21)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:dre04050]
    564874 (tnfrsf21)
   04090 CD molecules [BR:dre04090]
    564874 (tnfrsf21)
Cytokine receptors [BR:dre04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   564874 (tnfrsf21)
CD molecules [BR:dre04090]
 Proteins
  564874 (tnfrsf21)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNFR_c6 Death Ephrin_rec_like NCD3G
Motif
Other DBs
NCBI-GeneID: 564874
NCBI-ProteinID: NP_001036153
ZFIN: ZDB-GENE-030131-5971
Ensembl: ENSDARG00000001807
Vega: OTTDARG00000005709
UniProt: A5D8S6
Position
20
AA seq 637 aa AA seqDB search
MPGKMSLIWSLTLLLTVVGDVLTHTLTPIPTTEKPLSPRHYHHIDPATGNKLVCDKCPAG
TYVSFHCTEASVRECSPCPDGTFTRGENGVQQCHRCQRRCQAPFIEKTPCTSTTDRLCVC
PPGSFSQDGKCQRHSSCLPGWGVRKRGSETEDVRCQPCQRGTFSAITSDSLRCQTHTDCP
ALGLTLLIKGTKKTDNVCGPNPASSVPVLLGEASVSTVSSTESAYRASTAVLPAADIQDE
AEPVFSSTDMALGAQNFPTTTAYPEAIDKDGGLLIAATQDLPKSKLKLTLSRDPQLSNHQ
GVESISESKAQGLGYRPIRRGAPRPSSHKHFDINEHLPWMIVLLLLLVLVVIVVCSVKRS
SRVLKKGPRQDPSSIMEKAIHKKPSSPAQTKERWIYYSNGQGVDILKLVAAQIGSQWIDL
YKSLASATEREVAAFSNGYTADHERAYAALQHWTIRDSDANLAKLINALHRQRRIDVVDK
IRSVMEDNPQVDLNKLMTAVNVSHCLSPSHKPLESPGVAVEQSPMERSRGFFPDESEPLL
RCDSTSSKDSALSRTGSFITKEKKDTVLRQVRLDPCDLQPIFDDMLHILNPDELHVIEEI
PMAEDKLDRLFEIAGVKSQEASQTLLDSVYSHLPDLL
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgcctgggaaaatgtctttgatttggtcgctgacgctgctgcttactgtggtcggtgac
gtcttaacccacacgctgacccccatcccgaccacagagaagcccttgtctcctcggcac
taccaccacatcgaccccgccactgggaacaagctggtgtgcgacaagtgtccggcgggc
acctacgtgtcattccactgcacagaggccagtgtacgggaatgcagcccttgtccggac
ggcaccttcactcggggtgaaaacggtgttcagcaatgccaccgctgtcagagacgctgc
caagccccttttatcgagaaaactccctgcacatccaccactgatcgcttgtgtgtgtgt
ccgccaggcagcttctctcaggatggaaagtgtcagcgccactcatcgtgtctgcctggg
tggggcgtccgaaagagaggaagtgaaacagaggatgtacgctgccagccatgtcagcgt
ggcaccttttccgccattacgtcagactctctgaggtgccaaactcacacagattgccct
gcattgggcttaactctgctgatcaaaggcacaaagaagactgataatgtgtgtggccca
aatccagccagttcagtccctgtcctacttggagaagcctctgtttctacagtttccagc
actgagtcagcatatagagctagtacagcagttttgccagctgcagatatccaggatgaa
gctgagccagtcttcagtagcaccgacatggccctcggtgctcaaaattttcccacaacc
acagcttaccccgaggctattgataaagatggaggactcttaattgctgcaactcaggac
ctccctaaatcaaaactcaagctgactttatcaagagaccctcagctttctaaccatcag
ggtgtggagtctatttcagaaagcaaggcccaaggtttggggtaccgacccatccgcagg
ggagcaccaaggcctagttctcacaagcactttgacattaatgagcacttgccttggatg
atagtcctgctgcttctgctggtactggtcgtgatcgtggtgtgcagcgtcaagcgcagc
tcacgggtgttaaagaagggtcccagacaggatcccagcagcatcatggaaaaagccatt
cacaagaagcccagctctccagcacagaccaaggagaggtggatctactactcaaatggt
caaggtgttgacatcctgaagttggtggcagctcagattggcagtcagtggatcgacttg
tataaatctctggccagtgccacagaacgagaggtggccgccttttccaatggctacacg
gcggatcatgagagagcatacgctgctctacagcactggaccatacgagacagcgacgcc
aacctggccaaacttatcaatgctcttcaccgccaacgccgcattgacgtggtggacaag
atacgcagtgtcatggaagacaatcctcaggttgacctgaacaagctaatgacggctgtg
aatgtaagccattgtctgagccccagtcataagcctttggagtctcctggtgtggcggtg
gagcagtcgccaatggagcgcagcaggggattctttccagacgaatccgagccgctgctg
cgctgtgactccacttccagcaaagactctgccctcagccggacgggctcctttattacc
aaagaaaaaaaggatacagtgctgcggcaggtgcgtctggacccctgtgaccttcagccc
atttttgacgatatgctgcatattctcaaccccgacgagctccacgtcatcgaggagatc
ccgatggccgaggacaagctggaccgcttgttcgagatcgccggggtcaagagtcaagaa
gccagccaaacgctgctggattcagtctacagccacttgcctgacctcctttaa

DBGET integrated database retrieval system