KEGG   Danio rerio (zebrafish): 565082
Entry
565082            CDS       T01004                                 

Gene name
htra1b
Definition
(RefSeq) serine protease HTRA1B precursor
  KO
K08784  HtrA serine peptidase 1 [EC:3.4.21.-]
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dre01002]
    565082 (htra1b)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:dre03110]
    565082 (htra1b)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     565082 (htra1b)
Peptidases and inhibitors [BR:dre01002]
 Serine peptidases
  Family S1: chymotrypsin family
   565082 (htra1b)
Chaperones and folding catalysts [BR:dre03110]
 Other chaperones and cochaperones
  DegP / HtrA
   565082 (htra1b)
SSDB
Motif
Pfam: Trypsin_2 Trypsin IGFBP PDZ_6 PDZ_2 PDZ Kazal_2 Peptidase_S46 Kazal_1 Peptidase_S32 GRASP55_65 LSM
Other DBs
NCBI-GeneID: 565082
NCBI-ProteinID: NP_001104652
ZFIN: ZDB-GENE-080219-7
Ensembl: ENSDARG00000014907
Vega: OTTDARG00000034220
UniProt: A9JRB3
Position
12
AA seq 476 aa
MRLLILCASIILVPLLCDARIIKRYVIGCPERCDKSLCPPIPPDCLAGDILDQCDCCPVC
AAGEGESCGGTGKLGDPECGEGLECAVSDGVGATTTVRRRGKTGVCVCKSSEPVCGSDGV
SYRNICELKRVSNRAQKLQQPPIIFIQRGACGKGHEENPDSLRHRYNFIADVVEKIAPAV
VHIELFRKNVFNREVAVASGSGFVVSEDGLIVTNAHVVANKHRVKVELKTGTTYDAKIKD
VDEKADIALIKIDAPMKLPVLLLGRSADLRPGEFVVAIGSPFSLQNTVTTGIVSTTQRGG
KELGLRNSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDKIRQFL
AESHDRQAKGKTATKKKYIGVRMMTLTPTLAKELKQRKNDFPDVTSGAYVIEVIPKTPAE
VGGLKESDVIISINGQRITSASDVSTAIKTDESLRAVVRRGNEDIILTIIPEEIDP
NT seq 1431 nt   +upstreamnt  +downstreamnt
atgcgtcttttgattctgtgcgcgtctattattctggtaccgctgctgtgcgatgcgcgg
atcattaagcgttatgtgatcggctgtccggagcgctgtgataagagtctttgtccgcct
ataccgcccgactgtctggccggtgacatcctggaccagtgcgactgctgcccagtgtgc
gcggccggcgagggtgagtcctgcggcggcacagggaaactgggagacccggagtgtgga
gaaggtctggaatgcgctgtgtctgacggggttggtgcaacgactaccgtgagacggaga
ggaaagaccggcgtgtgcgtgtgcaagagttctgaaccggtctgcggcagtgatggggtg
tcctacaggaacatctgcgaactcaagagggtcagtaaccgggcgcagaagcttcagcag
ccacccatcatcttcatccagagaggagcctgcgggaaaggccacgaggagaatccagat
agtctccggcacagatataacttcatcgctgatgtggtggagaagatcgctccagctgtg
gttcacattgaattattccgcaaaaatgtcttcaatcgggaagtggcggtggccagcggc
tctggttttgtggtgtctgaagatggtctgattgtaactaatgctcatgtggtagccaac
aaacatcgggtgaaggtcgaactgaagacagggaccacctatgatgccaaaatcaaagac
gtagatgagaaagcagacatcgctctcatcaaaatagacgccccgatgaagctccctgtg
ctgttgttgggccggtcagctgatctgagaccaggtgaatttgtggtggcaattggcagt
ccgttctcccttcagaacacagtgaccacaggcatcgtcagcactacccagagaggtggc
aaagagctgggcctgcgcaactctgatatggactacatccagacagatgccatcatcaat
tatggtaattccggagggcccctggtgaatctggatggggaagtgattggaatcaacaca
ctgaaggtgaccgcaggaatatccttcgccattccctctgacaagatccgacagttcctg
gctgagtctcacgacaggcaggctaaaggaaaaacagccacaaaaaagaagtatattggt
gtgaggatgatgacgttaactccaacacttgctaaggagctaaagcagagaaaaaatgat
ttcccagatgtcacctctggtgcttacgtcattgaagttattcccaaaacaccagctgaa
gttggcggtttgaaggagagtgacgtcataatcagcattaacggtcagaggatcacatcg
gccagcgacgtcagcacggccatcaagacagacgaaagcctgagagcagtggtacggcgc
ggaaatgaagacattatcctcaccatcattcctgaagagatcgacccttga

DBGET integrated database retrieval system