KEGG   Danio rerio (zebrafish): 565319
Entry
565319            CDS       T01004                                 

Gene name
ahrrb
Definition
(RefSeq) aryl-hydrocarbon receptor repressor b
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dre03000]
    565319 (ahrrb)
Transcription factors [BR:dre03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    565319 (ahrrb)
SSDB
Motif
Pfam: PAS HLH PAS_9 PAS_3 BRE1
Other DBs
NCBI-GeneID: 565319
NCBI-ProteinID: NP_001029092
ZFIN: ZDB-GENE-051018-2
Ensembl: ENSDARG00000052618
Vega: OTTDARG00000020043
UniProt: Q3T2L2
Position
2
AA seq 573 aa
MIPPGDCLYAGRKRRKPVQKQKPEKADQKSNPSKRHRDRLNAELDRLGSLLPFSAEVITK
LDKLSVLRLSVSFLRVKSFFQAVQEKENHSADVSPTETRKEVQPCVVESDLLLQSLSGFA
LVVSSDGIIFYASSTIIDYLGFHQTDVMHQKVFDYIHVDERQEFRKQIHWAMNPGQQDTD
EDVVTAHLYSAEQPDGVSPELTPFLTRCFIARMRCLLDSTSGFLNMQFQGSLKFLQGQRR
RTLSGALLPPQLALFCVAVPLVLPSITELRMKSVTVKCKNRSSGRSEKRQRAPRGSYDSE
DELRYNWMSTFSQDASWAYSRKYRGDACKTQDEPLNSHVSTSVSSKLQTDDASWDARCPV
ALRTDSNENYQPGSFHKHNYSVKLRIGCNSHSQKYEVDDEKRYMMQNEAFNTLPEAAIKT
EQDSDSENGCNAYGMLWRPEYTQVKTEPEYYDYCSFYQKGKTTVSPYTNGHHKYLCAGVS
RPRKCVLYKDLNHSDVPIGNQGGYMFTNEHKNNMQRLAYEFRGHNRVHMIKQEPDDSPVW
CPEVIQGHVQHNIPANCTVSNAVHKGNPYVHMQ
NT seq 1722 nt   +upstreamnt  +downstreamnt
atgattccacctggagactgtctgtatgctgggagaaagaggagaaaacctgtgcagaaa
cagaaaccagagaaagcagatcagaaatcgaatccatccaagcggcaccgtgaccgtctg
aatgcagagctggaccggctggggagtctcctgccgttcagtgcagaggtcatcactaaa
ctggacaaactgtcagtgctgagactcagcgtcagcttcctgcgggtcaagagctttttt
caagcagtacaggagaaagaaaatcacagtgctgatgtttcacccacagagacgaggaaa
gaagttcagccgtgtgtggtagagagtgaccttctcctgcagtctctctctggatttgca
ctagtcgtgagctcagatggcatcattttctatgcatcatctactatcattgactacctg
ggatttcatcagacggacgtgatgcatcagaaagtctttgattatatccatgtggacgag
cgtcaggagtttcggaaacagatccactgggcgatgaaccccggccagcaggacactgat
gaggatgttgtgacggctcatctgtacagcgctgaacagcctgacggtgtttctcctgaa
ttgactccgtttcttacgagatgtttcattgctcgaatgagatgcctgctggacagcacc
tccggcttcctgaacatgcagtttcagggcagtctgaagttcctgcagggtcagaggagg
aggacgctttctggagcgctgctgccacctcagttggctctgttctgtgtggctgttcct
ctagtgctgccctccatcacagagctcaggatgaagagcgtgacggttaagtgcaaaaac
agaagctctggccgcagtgagaaaaggcagcgagctccccgagggtcatatgacagtgaa
gacgagctgcgttataactggatgagcactttttctcaggacgcttcatgggcatacagc
agaaaatacagaggagacgcctgcaaaactcaagacgagcctctcaactcgcatgtttcc
acttcagtgtcctctaaactgcagacggatgatgcatcatgggacgcccgctgtcctgtt
gccttgcgcacagactccaatgaaaactaccaaccgggaagcttccacaaacacaactac
tctgttaaattacgaattggttgcaactcacattcacagaagtatgaagtggatgatgag
aaaagatatatgatgcaaaatgaagcttttaacacactccccgaagccgccatcaaaacc
gaacaagattctgactctgaaaatgggtgtaatgcatacgggatgctctggcgccctgaa
tacacgcaggtgaaaaccgagcctgagtattatgactactgcagcttctatcaaaaaggt
aaaaccaccgtcagtccttacaccaatggacaccacaagtatctgtgtgcaggagtgagc
agaccccgaaagtgtgtcctgtataaagacctgaatcactcggacgtgccgatcgggaat
caaggcggatatatgttcactaatgagcataaaaacaacatgcagcggctggcttatgag
tttagaggtcataaccgggtgcacatgatcaaacaagaacctgatgattctcccgtttgg
tgtcctgaggttattcaaggacacgtgcaacacaatatccctgcaaattgcactgtgagc
aacgctgtgcacaaaggaaacccatatgttcacatgcaatga

DBGET integrated database retrieval system