KEGG   Danio rerio (zebrafish): 565370Help
Entry
565370            CDS       T01004                                 

Gene name
comtb
Definition
(RefSeq) catechol O-methyltransferase
  KO
K00545  catechol O-methyltransferase [EC:2.1.1.6]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00140  Steroid hormone biosynthesis
dre00350  Tyrosine metabolism
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    565370 (comtb)
  Amino acid metabolism
   00350 Tyrosine metabolism
    565370 (comtb)
Enzymes [BR:dre01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     565370 (comtb)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   565370 (comtb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_3 Methyltransf_24 Methyltransf_31 PCMT CmcI
Motif
Other DBs
NCBI-GeneID: 565370
NCBI-ProteinID: NP_001077312
ZFIN: ZDB-GENE-040724-164
Ensembl: ENSDARG00000025679
Vega: OTTDARG00000023792
UniProt: A4IG53
Position
11
AA seq 264 aa AA seqDB search
MLGVLLCWCLGASVLLYVLYSWLIPAAVQFNGSLALLWHDVIVERALDSLTRSTRPQRLL
KAVKQHATRGDPQSVISAIDHFCRHREWAMNVGDEKGCILDSVVSELNPEKVLELGTYCG
YSTVRIARLLPPGARLITLEFNPDYAVIARQVIAWAGIEDKVQLVEGASEDWIPRMKEHF
GIETFDLVFLDHWKDHYLPDTKLMEGCGLLRKGTVLLADNVICPGVPDYLEYVRNSRSYK
SCYFKSHLEYTRAEDGLEKSVFLG
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgttgggggtgttgctgtgctggtgtttaggggcctcagtgctgttatacgtcctgtac
tcgtggctgattcctgcagcggtgcagtttaatggcagtctggcgttactctggcatgat
gtcatcgtggagcgagctttggattccctgacccgatcaactcgaccacagcgtctgctg
aaagctgtaaagcagcatgcgactcgaggcgaccctcagagcgtcatctctgccattgat
cacttctgcagacaccgcgaatgggctatgaatgttggagatgagaaaggctgtatcctg
gattcagtggtaagtgagctgaacccagagaaggtcctggagttgggcacatactgtggc
tactctacagttcgcatcgctcgtctgcttcctcctggagctcgtctcattacactggag
ttcaacccagattacgctgtgattgctcgacaagtcatcgcctgggctggaattgaagac
aaagtgcagcttgtagaaggtgcgtctgaagactggatcccacgcatgaaggagcacttt
ggaatcgaaacctttgatttagtttttctggaccactggaaagaccattaccttcctgac
actaaattaatggagggttgtggtctgctaaggaaaggcacggttcttcttgctgataat
gtgatctgtcctggagtcccagactatcttgaatatgtgcgcaatagccgttcctataaa
agctgctattttaaatcccatttagagtacaccagggcagaggatggcttggagaagtct
gtgtttttgggctag

DBGET integrated database retrieval system