KEGG   Danio rerio (zebrafish): 565446
Entry
565446            CDS       T01004                                 
Symbol
tjp2a
Name
(RefSeq) tight junction protein ZO-2a isoform 1
  KO
K06098  tight junction protein 2
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04530  Tight junction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    565446 (tjp2a)
SSDB
Motif
Pfam: PDZ PDZ_6 Guanylate_kin PDZ_2 Peptidase_M50 SH3_2 SH3_1 DUF6288
Other DBs
NCBI-GeneID: 565446
NCBI-ProteinID: NP_001188499
ZFIN: ZDB-GENE-070925-2
Ensembl: ENSDARG00000063309
UniProt: E7FBB9
Position
10:complement(15815865..15879596)
AA seq 1221 aa
MPVVVEKRQFLCRNVKDCYYNPVMEETVWEQYTVTLQRDSKMGFGLAVSGGRDNPNEESG
EMSIVISDVLQGGPADGLLFENDRVVQVNTVPMDGVPHSFAVQTLRKCGKVAKITVKRCR
KIPVNLTKRAASPDDRVFSGDYNDDYDYEQDQHSIYSGRSYPNRDTSLERERGGYADERE
RDYDRSRGRSMERGVSPDRQYRRDGSRGRMLDNERCPDPRYRSENTLDRDRSPDPRYRSE
RTLDRNYSPERGRRFRSEHNLDRERSPDTQYRSDRTLDRTHSPDTHYRPEPARGYSRENL
TSDNERRRYGSHQNEPMKKSNSQDRLDRSPSPAPLRHNALEKPLSVTLLKNRPNDEYGLR
LGSQLFIKEMTNTGLASREGKLQEGDIILKINGTVTENLSLSDAGKLIEKSRGKLQLVVQ
RDRSQVLIRIPPMADSDSEMDDISEIESYRSYSPQEDRRSHHSDLSSHSSNERLQDKNRE
EPPKRLAKMGAMPTPFVSAPVDLPPPPVEKEEPRSESPAPPVVIAAPKTVPVKAKPLPKV
PLLPSPEEQEIYGPNTVMVRFVKGESVGLRLAGGNDVGIFIAGVQEDSPAEVEGLRTGDQ
IVKVNNMDFRGMVREDAVLYLLEIPKGEDVTILAQSKPDVYKDILGSGRGDNFFIRTHFE
YEKELPQSLNFSRGEVFKVVDTLYDGKLGNWLAIRMDKDNQLLEKGIIPSKSRAEQMANV
QHAQKGAGNDRGDFWRLRGQRAAKKKDLRKSREDLSAAPVTTRFPAYERVVLREAGFRRP
VVIFGPISDAANEKLANELPNEFTIAKTEPKDAGSEKSSGVVRLNTIRQIIEQDLHALLD
VTPKAVDTLNYTQWYPIVIFLNPDSKQGVKTMRNRLVPGSNRSSRKLYEQAVKLRKTYAH
LFTATIDLNSSHDAWFGSLKDAVREQQDKAVWVCQSKLDGSEEDLDLHDDRMSYLSAMSA
DYLSMDSRLTSDYEDTADEGGAYTDNELDESTDEPQPMSAISRSSEPVSEERHMPVPHER
SKKPSGRDVQRDPSPPPSFVPEPPKVRSASRPADSRSFDSRSSSTISSDAPISNKPLPPP
VAQKPSFNTRSADDTPSNDPADDPANRTFRGKVKAFEQMDHLARAKRMLELQEAEQARLE
ISQKHPDIYAVPNKPKPNQNRPQPIGSSSNSESQSSSKAMYSERGSHYRHDDDDEEEYRR
QLADQTRRGYYSTQKYNDTEL
NT seq 3666 nt   +upstreamnt  +downstreamnt
atgcccgtcgttgtggagaaacggcagtttctgtgtagaaatgttaaggactgttattat
aacccagtcatggaggagactgtgtgggagcagtacactgtgaccctacagcgggactcc
aagatgggctttggcctagcggtgtctggaggacgggacaatccaaacgaagaaagtgga
gaaatgtcaatcgtcatatctgatgtgctgcaagggggtccagccgatggcttgctgttt
gaaaatgacagagtggtccaggtcaacactgtgccgatggacggtgtcccacactccttt
gcagtccagactctccgcaaatgtggcaaagttgccaaaattactgtaaagcgatgtaga
aaaatccctgtcaacctgaccaagcgtgctgcatcccctgatgaccgtgtcttcagtggc
gactacaacgatgattatgactatgaacaggaccagcacagcatctacagtggacgcagc
taccctaaccgtgatactagtttagagcgtgagcgcggcggctatgctgacgagcgtgaa
cgggactatgatcgcagtcgggggaggagcatggagcgcggcgtgagccctgatagacaa
tacaggcgggacggcagccgcggacgaatgctggacaacgagcgctgccccgacccccgt
tacagaagtgaaaataccttggatcgcgaccgcagtccagacccccgttatcgaagtgaa
cgcacgctggaccgcaactacagcccagagcgaggtcgccgctttcgcagcgaacacaac
ctggaccgagagcgaagtccagacacacaataccgcagcgatcgcacactggacagaaca
cacagtccagatacacactataggcctgaacctgctcgggggtacagcagagagaatctc
accagtgacaatgagcgcaggaggtatggctcacatcagaacgaacccatgaagaagagc
aacagccaagacagattggatcgttcgccttcacctgcaccactccgacacaatgccttg
gaaaagccactcagtgttactctcctcaaaaaccgtcccaatgatgaatatggccttcgt
ctaggcagtcagttgttcatcaaagagatgacgaacacaggccttgcatccagggaaggc
aaactacaagaaggagacattattctgaaaatcaacggtacggtcacagagaatctgtct
ctgagcgatgcagggaagctgattgagaagtctcgtggaaagctgcagctggtggtgcag
agggatcgcagtcaagtgctcatccgcatcccaccaatggcagacagcgactcggaaatg
gatgacatctctgagatcgagtcgtaccgctcatattctcctcaggaggatcggcggagt
catcactcagacctctcctcacactcctccaatgagagattacaggacaaaaacagagaa
gagcctcctaaaagactggctaaaatgggagcgatgcccactccatttgtatcagcaccg
gtggatctgccacctccacctgtagagaaagaagagcctcgcagcgagtctccagctcct
cctgtggtaattgctgctccaaaaactgttccagtaaaagcaaaacctttgccaaaggtt
cccttgctacccagtccagaagagcaggaaatttatgggcccaacactgtgatggtgcgc
tttgtgaagggtgaaagcgttggtctgcgtctggctggaggaaatgatgtgggcattttc
atcgccggcgttcaagaggacagtcctgccgaggtggagggtctgcgcactggagaccaa
atagtcaaggtgaataacatggattttcgaggcatggtccgtgaagatgcagttctgtat
ttactggagattcccaaaggagaggatgtgaccattttggctcaaagcaaacccgatgtg
tataaagacatcctggggtctggacgaggtgataacttcttcatcaggactcattttgaa
tatgagaaagagcttccccagagcctgaacttctctagaggagaggtttttaaagtggtg
gacaccctgtatgatggcaagctgggaaactggctcgccatccgcatggacaaagacaat
cagctcctggaaaagggcatcatacccagcaagagcagggcggagcagatggcaaatgtt
cagcatgcacagaaaggtgctggtaatgacagaggcgatttctggaggctcagaggtcaa
agggcagctaagaaaaaagaccttcgcaagagcagagaggatctcagtgcagctccagtc
accacacgcttcccggcctatgagagagtggtgctgcgtgaagctggcttcaggcgtcca
gtcgtgatttttggccccatttcagatgcagccaacgaaaaacttgccaatgaacttcca
aatgagttcaccattgcaaagaccgaaccaaaagacgcaggctcagaaaagtcatctggc
gttgtgaggctaaacaccattcgtcagatcatcgaacaggatctacatgctctgctggat
gtcactccaaaggctgtagacaccctcaattacactcagtggtatcccattgtcatcttc
ctcaacccagacagcaagcagggggtgaagaccatgaggaatcgcttggtgcctggatcc
aaccgcagctcacgcaaactttacgaacaagcggtcaaactgcggaagacatatgcgcat
ctgttcacagctaccattgatctgaactcttctcacgatgcctggtttggaagcctcaaa
gacgccgtacgagaacagcaagataaagctgtctgggtctgtcaaagcaagctggatggc
tcagaggaggacctggatctccatgatgaccgtatgtcctacctgtcggccatgagtgca
gattacctgagcatggacagccgtctgaccagcgactatgaggacacggcggacgagggc
ggcgcatacactgataatgagcttgatgagtccacagatgagcctcagccaatgtctgcc
atcagccgctcatctgaacccgtcagtgaggagaggcacatgcctgttccccacgagcgc
tcaaagaaaccatcgggcagagacgtccagcgtgaccccagtcctcctccgtcatttgtc
ccagaacccccaaaggtgcgctctgcttcccgtcctgcagactccaggagttttgactcg
cgctccagcagcaccatcagcagtgatgcgcccatcagcaacaaacctcttcctccgccc
gtcgcccagaagcccagtttcaatacgaggtcggcggacgacacaccttctaatgaccca
gcagatgaccctgccaaccgcaccttcaggggaaaggtgaaggccttcgagcagatggac
caccttgccagagccaaacgtatgctggagctgcaggaggccgaacaagcccggctggaa
atctctcagaaacatccagatatttatgcagttcctaacaagccaaaaccaaaccagaac
agaccacaaccaattggctccagctcaaactccgagtcccagagctcctccaaagcaatg
tattcagagagaggctcacactaccggcacgatgatgatgacgaagaggagtatcgccgc
cagctggcggaccagacccggagaggatattacagcacacagaaatacaatgacacagag
ctctaa

DBGET integrated database retrieval system