KEGG   Danio rerio (zebrafish): 565458Help
Entry
565458            CDS       T01004                                 

Gene name
fan1
Definition
(RefSeq) fanconi-associated nuclease 1
  KO
K15363  fanconi-associated nuclease 1 [EC:3.1.21.- 3.1.4.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    565458 (fan1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:dre03400]
    565458 (fan1)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.1  phosphodiesterase I
     565458 (fan1)
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.-  
     565458 (fan1)
DNA repair and recombination proteins [BR:dre03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     565458 (fan1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VRR_NUC zf-TRAF
Motif
Other DBs
NCBI-GeneID: 565458
NCBI-ProteinID: NP_001038546
ZFIN: ZDB-GENE-030131-6225
Ensembl: ENSDARG00000062269
Vega: OTTDARG00000012965
UniProt: Q1LWH4
Position
18
AA seq 988 aa AA seqDB search
MESLTGRKSARRLSVTKKKSQSVCPIKERTSNGGAASITSFFRNTPPSKLACPLCGKLVP
RYKINEHIDSQCQNFLVEDDGKQKEITKAPSNSALASNNEREKSPGDKDADTSPFFKKNC
AVRRDSSETDSQAKPVKTVGLGSLSSKLSRRALRLSDESGVNLTHVSDNENDHNAELNRS
QKENYMNSLTFGSERNGTDADNILETEPEASNQPQLKNVEKSASDSSISSDVHTSSSSVL
KRKSMEIPKNDTNTTETCIAHKKSRFFQSSIERGDESKVKSDQTEASSSAYDVPTSKSPI
KSKTTQEEIEKELNKTPANEHNMLDVEKVGEGSEQQPTRLPYYLRNFRTVLEAVLENEDD
RRLFNEDDFSTIQSFQQLSVPGQMLYVRLFQRKLKWLQVYKVEYTEISTDLRPVVQELVA
CGFLQTESELHDLHEVLDLLPAPELRNLAKTFHLGRGGSQKQQLVEGLLQLGKQRSLFAG
QNNTAAVILKRAKQAAGSCVRLCRSSRVVFSRVLLLFTLTDTLEEEDLASGGQGQLYTIL
LVNSGRLAFPEYTVHRSARLFKDRDDLIRYETAMRALQEVIAAMQSGSWEAAYDLYTTAM
AAWQEIKDSCDLNHQEQLPVFLRCFTVGWTYTRILSRGVEILQRLKRYEDAVEQLRNLLS
QSVYCVDSRGRWWDRLALNLQQHLKQHEQAIGAIRDGLNDPLARTGHKLSLYQRASRMKE
SASLKKYRLLLRDLPTVHVQDVTHVTIRGQLFPHEGGMGKSVFLRAASEDEGSGGGQGTV
VMCSVEDLALEHYRTLGFDQGIHGEGSTFSTLFGLLMWDIIFMDGVPDVFLNPYQTCPLD
LHTDCFYGSRREAIEARAEMLREASVEILQDLIADVWSTQEGRVCALINWERFSTPQQAQ
SLVACLGGHFLSGVFLRMAKDYRHCRGGLPDLVVWSTSSNKYKLVEVKGPNDRLSQKQQI
WLDELRKLGADVEVCHVTATGARGARRE
NT seq 2967 nt NT seq  +upstreamnt  +downstreamnt
atggagtctctgaccgggagaaaaagtgccagaagactctcagtgaccaagaaaaagagc
caaagtgtctgtcctattaaagaaagaacaagtaatggaggagctgcttctataacctca
tttttcaggaatacaccaccaagtaaacttgcctgtcctctgtgtggcaaacttgtacct
cgttacaagattaatgaacacatagactcccagtgtcagaactttcttgtggaggatgac
ggaaagcaaaaggaaatcaccaaagcaccttctaacagtgctttagcatcaaataatgag
agagagaaaagtcccggagacaaagatgctgatactagtccgtttttcaaaaagaactgt
gcagtgaggagagattcatctgaaacagattcacaagctaaaccggttaagactgttggt
ctgggaagtttatcctctaaactctctagacgagcacttagactttcagatgagtccgga
gtaaatcttactcacgtctcagataatgaaaatgatcataatgcagaattgaacagatca
cagaaggaaaactacatgaatagtttaacttttgggtctgaaagaaatggcacggatgca
gataatatattagaaacagagccagaagcttcaaatcaaccacagcttaaaaatgttgag
aaatctgcatcagattcaagcataagcagtgatgttcacacatcctcatccagtgtactg
aagcgaaagtccatggagatacctaaaaatgacacaaacactacagaaacatgtattgca
cataagaaaagtagatttttccaaagcagtattgaaagaggagatgaatctaaggtcaaa
tcagatcaaactgaagcttcgtctagtgcatatgatgttccaacatcaaagagtccaatc
aaaagcaaaaccacacaggaggagattgagaaggagctgaataagacaccggctaatgaa
cacaacatgcttgatgttgagaaagtgggtgagggatcagagcagcagcccaccaggctg
ccttattatctgcgaaactttcggactgtccttgaggctgtgttggagaatgaggatgat
aggaggctcttcaatgaagacgacttctcaacaattcagtcttttcagcagctttcagta
cctggtcagatgctttatgtccgtctgtttcaaaggaagctgaagtggcttcaggtctat
aaggtggaatacacagagatcagcacagatctcagacctgtcgttcaagagcttgtcgca
tgtggcttcctacagacagaatctgagcttcatgatctccacgaagttttggatctgctt
ccggcaccagagcttagaaacctggccaaaacatttcaccttggccgtggagggagtcag
aaacagcagttggtggagggtttgctccagctggggaaacagcgatctctctttgctggt
caaaacaacacagctgcagtcattctcaagagggctaagcaggctgcaggctcctgtgtg
cgtctgtgccgcagctctcgtgttgtgttttcccgggtcctgctcctcttcaccctcaca
gacactttagaggaggaagatttggcttctggagggcaggggcagctctacaccattctg
ctggtcaattctggtcgtctggctttcccagagtacaccgtacatcgctcagccagactc
tttaaggacagggatgacctcatcagatatgaaactgcgatgcgtgcgcttcaggaagtg
attgctgcaatgcagtcgggcagctgggaagccgcctatgacctctatactacagcaatg
gccgcctggcaggagattaaagattcctgtgacttaaatcatcaagaacagctgcctgtg
tttctgcgctgtttcactgtgggctggacctacactcgcatactttctcgtggagttgag
attttgcagagacttaagcgctacgaggatgcagtggagcagctgagaaatctcctgtct
cagtcggtgtattgtgtagacagtagggggcgctggtgggacaggcttgctctcaatctc
cagcaacacctgaaacagcatgagcaggccatcggtgctatcagggatggactgaatgac
cctctggcccgaacaggacataagttgtcactttaccagcgagcttcgcgaatgaaggag
tctgctagcttgaagaagtatcgtctgttgctccgggatctgcctactgtccatgtacag
gatgtcactcatgtgacgattcgaggccagctctttcctcatgagggtggtatgggtaaa
tcagtgttcctccgagcagccagtgaggatgaaggctctggaggaggacaagggactgtg
gtgatgtgttcagttgaggatctggctctggagcactacagaacacttggatttgatcaa
ggtattcatggagaaggatctacattttccaccctgtttggactcctcatgtgggacatc
attttcatggacggggttcctgatgtcttcctaaacccctaccagacgtgtcctctggat
ttgcacacggattgtttctatggcagtcggcgggaggccatcgaggctcgtgcagagatg
ttgcgtgaggcatctgtagagatactgcaggatctgatcgctgatgtgtggagcacgcag
gagggaagagtgtgtgcgctgataaactgggagcgattctccacgcctcagcaggcacag
agtctagtggcatgccttggtggccacttcttgagtggtgtgttcctcagaatggccaaa
gactacaggcactgcagaggaggacttccagatctggtggtctggagtacttccagcaac
aagtataagctggtggaagtgaagggccctaatgaccgtctgtcccagaagcaacagata
tggctggatgagctgcgtaaactcggggcagatgtagaagtgtgtcacgtcacggctact
ggagcacgaggagctcgacgggagtga

DBGET integrated database retrieval system