KEGG   Danio rerio (zebrafish): 565714
Entry
565714            CDS       T01004                                 

Symbol
wnt7aa
Name
(RefSeq) wingless-type MMTV integration site family, member 7Aa
  KO
K00572  wingless-type MMTV integration site family, member 7
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04150  mTOR signaling pathway
dre04310  Wnt signaling pathway
dre04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    565714 (wnt7aa)
   04150 mTOR signaling pathway
    565714 (wnt7aa)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    565714 (wnt7aa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:dre00536]
    565714 (wnt7aa)
Glycosaminoglycan binding proteins [BR:dre00536]
 Heparan sulfate / Heparin
  Morphogens
   565714 (wnt7aa)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 565714
NCBI-ProteinID: NP_001020711
ZFIN: ZDB-GENE-051129-1
Ensembl: ENSDARG00000044827
Vega: OTTDARG00000020431
UniProt: Q4JLT0
Position
11
AA seq 349 aa
MSRKTRRWIFHIFLCLGIIYLKIGGFSSVVALGASIICNKIPGLAPRQRTICQSRPDAII
VIGEGAQMGINECQFQFKNGRWNCSALGERTVFGKELKVGSKEAAFTYAIIAAGVAHAIT
AACTQGTLSGCGCDKEKQGFYNQEEGWKWGGCSADIRYGLSFSKVFLDAREIKQNARTLM
NLHNNEVGRKILEKNMRLECKCHGVSGSCTTKTCWTTLPKFRQLGYILKERYNHAVHVEP
VRASRNKRPAFLKVKKPYSYRKPMDTDLVYIEKSPNYCEADPVTGSMGTQGRICNKTAQH
TNGCDLMCCGRGYNTHQYSRVWQCNCKFLWCCYVKCNTCSERTEVYTCK
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgagcaggaaaacgcgccgctggatttttcacattttcctctgtttggggattatttat
ttgaagattgggggcttttcctcggtggttgcattgggagcgagtattatctgtaacaaa
attcctggtttggcccctcgtcaaaggactatctgtcaaagccggcctgacgctatcatt
gtcattggagaaggagcgcaaatgggaatcaatgagtgtcagtttcaattcaaaaatgga
aggtggaactgctcggccctcggggaaagaactgtctttggaaaagagttgaaagtgggg
agtaaggaggcagccttcacttacgccatcatcgctgccggggtcgcccatgccatcacg
gcagcttgtactcagggtacactaagcggctgtggatgtgacaaggagaagcaaggtttc
tacaaccaggaggagggctggaagtggggaggatgctcggctgatattcgctacggtctg
agcttctcaaaggtcttcctagatgcacgggagatcaagcagaacgccaggacactcatg
aaccttcataacaatgaagtaggacgcaagatcttggaaaagaacatgcgtttagagtgt
aaatgccatggcgtatctggatcctgcaccaccaagacttgctggaccactctccccaag
tttcggcagctgggttacatcctcaaggagaggtataaccacgccgttcatgtggaacca
gtccgcgccagtcggaacaagagaccggcctttctgaaagttaaaaaaccgtactcctac
aggaagcccatggacacagatttagtatacattgagaagtcacccaactattgtgaggca
gatcctgtaacgggtagcatgggaacccagggaaggatctgcaacaagactgcgcagcat
accaatggctgcgacctcatgtgctgcggacgaggatataacacacaccagtactcgcgt
gtctggcagtgcaactgcaagtttctttggtgttgctacgtcaagtgcaatacctgtagt
gaacggacagaagtgtacacatgcaagtga

DBGET integrated database retrieval system