KEGG   Danio rerio (zebrafish): 565797
Entry
565797            CDS       T01004                                 
Symbol
lrp1ab
Name
(RefSeq) low-density lipoprotein receptor-related protein 1 isoform X2
  KO
K04550  low-density lipoprotein receptor-related protein 1 (alpha-2-macroglobulin receptor)
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dre04131]
    565797 (lrp1ab)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:dre04090]
    565797 (lrp1ab)
Membrane trafficking [BR:dre04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    565797 (lrp1ab)
CD molecules [BR:dre04090]
 Proteins
  565797 (lrp1ab)
SSDB
Motif
Pfam: Ldl_recept_a Ldl_recept_b FXa_inhibition DUF5050 SGL cEGF EGF_CA EGF
Other DBs
NCBI-GeneID: 565797
NCBI-ProteinID: XP_005162276
ZFIN: ZDB-GENE-030131-7126
Ensembl: ENSDARG00000029146
UniProt: F1QY34
Position
23:complement(25451457..25687396)
AA seq 4549 aa
MPSCNANMLAVGLLYLGLVLALEVVDPTRAIEAPKTCSPKQFVCKDQVTCISKGWRCDGE
KDCPDGSDESPDICHHTQVTQCPPNEFECRGTDVCIHLSKLCDGVPDCTDGRDEGPHCRE
LASKCSIMDCQYNCSVTLSGPKCYCKNGYEVGEDGKTCKDFNECAVYGTCSQTCTNSEGS
YTCSCVEGYLPQLDNRSCKAKNDPVDRLPFLLIANSQNIQATSLSGANPITINDKQTTTM
DFIYAQETVCWIHMGDSPTASQLKCAKFPNAKSFTEEKTINISLSLHHMEQMAIDWLTGN
FYFVDNVDDRIFVCSKDGSICVILLDMELYSPKGIALDPAMGKVFFTDYGQTPKVERCDM
DGQNRTKLVDSKIVFPNGITLDLANKLVYWTDAYLDYIEVVDYEGKNRHTIIQGLLIEHL
YGLTVFENYLYATNSDNANMQPKTSVIRVNRFNSSDFQVVTRVDKGGALHVYHQRRQPTV
RSHACALDPFGKPGGCSDICLLANSHKTRTCRCRSGFSLGSDGKSCKKPEHELFLIYGKG
RPGVIRGMDMHSTVYDEHIVPIENLNNPRALDFHAETEFIYFADATSYIIGRQKLDGTER
DIIVKDGIHTVEGIAVDWMGQNLYWTDDGPKKTISVAKLEKASQTRKTLIEGKMTHPRAI
VVDPSHGMMYWSDWEEEPKEMNRGSIRKAWMDGSNAGILLTSKTVLWPNGLSLDIQQGLL
YWVDAYYDRIEMVLLNTTERRTVYEGQELNHPFGLCHHKNFLFWNEYRGGGIYKLDQNTK
KATLLRNERPPIYEIRTYDAQQQQIIGSNVCRANNGGCSSLCLLTPTGRSCACADDQILD
TDNKTCRANPSYVPPPQCQPGEFACKNNRCIQERWKCDGDNDCLDNSDETPDLCNQHTCP
ADRFKCQNNRCIPLRWLCDGDNDCGNDEDESNSTCLARTCPSNQYPCASGRCIPVSWMCD
LDDDCGDRSDEPASCAYPTCYPLTQFTCANGRCINVNWRCDNDNDCGDNSDEAGCSHSCS
SVQFKCNSGRCIPEYWTCDGDNDCGDYSDETHANCTNQATRPPGGCHTDEFQCRMDGLCI
PMRWRCDGDTDCMDLSDEKNCEGVTHMCDPAVKFACKDSARCISKAWVCDRDSDCEDNSD
EENCEALECKLSHHVCASNDSICLPPEKLCDGKDDCPDASDEKLCNLCTVENGGCSHNCT
IAPGEGVLCSCPAGMELGTDNKTCQIQSFCAKHLKCSQRCVQEKATVKCACYEGWALGPD
GESCKSTDPFKPFIIFSNRHEIRRIDLYKGEFSVLVPGLRNTIALDFHFNQSSLYWTDVV
EDKIYRGKLSENGALTSFEVVIQYGLATPEGLAVDWIAGNIYWVESNLDQIEVAKLDGTM
RTTLLAGEVEHPRAIALDPRDGILFWTDWDASSPRIEAASMSGEGRRTIHKETGIGGWPN
GLTVDYLERRILWIDARSDAIYSAAYDGSGLIEVLRGHEHLSHPFAVTLYGGEVYWTDWR
TNTLARANKWTGHNVTVVQRTNTQPFDLQVFHPSRQPQAPNPCAANDGKGPCSHLCLINY
NQTFSCACPHLMKLKADKHTCYEYRQFLLYARQIEIRGVDIDNPYYNYIISFTVPDIDNV
TVVDYDALEHRIYWSDVRTQTIKRAFINGTGVETVVSADLPNAQGLAVDWISRNLFWTSY
DTNKKQINVARLDGSFKNAVIHGQGLDKPHCLVLHPILGKLYWLDGDNISMANMDGTNHT
LLFTNQKGPVGLSIDFDSEQLYWISSRNSTINHCKMDGSGLEVIESVKGKLTKATALAIM
GDKLWWADQSTDQIGTCDKSDGGNWKVLRYHTSPMMHMKIYNESVHQIGTNLCSKNNGDC
SQLCLPTSPSTRACMCTAGYSLKSGQQSCEGMGSFLLYSVHEGIRGIPLDPSDKSDALVP
VSGTSLAVGIDFHADNDTIYWVDMGLSTISRAKRDQTWREDIVTNGIGRVEGITVDWIAG
NIYWTDQGFDVIEVARLNGSFRYVVISHGLDKPRAIAVHPEKGYLFWTEWGQYPRIERSR
LDGSERVVLVNVSISWPNGISIDYQEGLLYWCDARTDKIERINLETGENRELVLSSNNMD
MFAVSVFEDYIYWSDRTHANGSIKRGNKDNATDMVYLRTGIGVQLKDIKVFNRARQQGTN
VCKVNNGGCEQLCLFRGNGNRTCACAHGMLAEDGHSCRDYDGYLLYSERTILKSIHLSDE
TNLNAPIKPFEDPEHMKNVIALTFDYRGGGGKGANRIFYSDIHFGNIQHINDDGSDRKTI
VDNVGSVEGLAYHRGWDTLYWTSYTTSTITRHTVDQSRSGAFDRDTVVTMSGDDHPRAFV
LDECQDLMFWTNWNEQSPSIMRASLSGANVLVIIGNNIRTPNGLAIDHRAEKLYFSDATF
DKIERCEYDGSRRFVVLKNEPVHPFGLAVYGDYIFWTDWVRRAVLRADKYGRDMKVLRAD
IPQQPMGIIAVAKDTNSCEFSPCLTNNGGCQDLCLITSEGRVNCSCRGERKLLGDNTCVA
ENTTCNSVDEFECGNGDCIDYSLTCDSLAHCKDKSDEKQAYCANRMCKKGYRRCINGRCI
KHSSWCDSTDDCGDGSDELPCNMTLCSAAEFQCKDGSCITNSSRCNQVVDCEDASDEMNC
SPTDCSSYYLLGVKGMTFERCEFTTLCFAPSWRCDGSNDCGDFSDERNCPEKRQQKCSEN
NFACPSGRCIPMSWTCDKENDCEDGADEAHCEKFFQFCASNQFECGNHRCIFKTWVCDGT
DDCGDGTDEDSRCKAKTCGPDSFQCPGSHVCILQRWVCDGDKDCPDGGDEGLKAGCVFNK
TCDDTEFQCQNSQCIPKNFMCDHDIDCRDGSDESPECEYPTCGPNDFHCANGQCLKQKNW
ACDGEFDCRDQSDEAPKNLQCTDTESRCNDTAFLCSSGKCVNETLLCDNNNDCGDGSDEN
NCFVNECLNSKLSGCSQLCEDLKIGFKCRCNAGFRLKQDGKTCVDLDECSTVYPCSQRCI
NTHGSFHCLCVDGFVPRPDDHTSCKSTAEEEPFLIFANRYYLRKLNLDGSNYTLIKQGLN
NAVALDYHYAEQMIYWTDVTTQGSMIRRMHINGSNVQVLHRTSLSNPDGLAVDWVGGNLY
WCDKGRDTIEVSKLNGAYRSVLVNSGLREPRAVAVDVRNGYLYWSDWGDVPHIGRIGMDG
TDRQIIIQDKITWPNGLTLDFINDRIYWADAREDYIAFASLDGSNRHTVLNHDIPHIFAM
TLFEEFIYWTDWETKSINRAHKTLGTNKTLLISTLHRPMDIHIFHPSRQPEVSGHPCQED
NGGCSNLCLLSPGGGYKCACPTNFYLAADGKQCLSNCTASQFVCKNDKCIPFWWKCDTED
DCGDRSDEPADCPEFKCRPGQFQCGTGLCTNPAYICDGDNDCQDNSDEANCDIHVCLPSQ
FKCSHPSRCIPGILRCNGQNNCGQGEDEKDCPEVTCAPNQFQCAITKRCIPRVWVCDRDY
DCVDESDEPANCTQMKCGVDEFRCKDSGRCIPSRWTCDGEDDCGDASDEPKEECDERTCE
PYQFRCKNNRCVPGRWQCDYDNDCGDNSDEEKCVPRQCSESEFACSNGRCIAGRWKCDGD
HDCSDGSDEDGCDLKCEEDQFQCKNGHCIPLPWRCDADVDCLDGSDEERCEITEVRHCSS
EEFQCNNTLCKPLSWKCDGEDDCGDNSDENPEACRHFQCPPTRNFRCRNNRVCLTRSKLC
DGVDNCGDNSDEASCDYESTCDKDQFRCTNGKCISANLRCNFFNDCEDYGSDEIGCKTDT
MLNDCKSNKSLCGDGDEAHCVSNGTDTFCSCKPGFQSVRHNTCEDKDECKQFGVCSHVCN
NTKGSYKCSCHKYFTRINHTCKADGQNSNKQVLYIADDNEIRSLNPGMPNWVYEQTFQGD
NNVRIDAMDLHVKTNRIFWTNWHTYGISCFQLPSQSSASGPTSNSHRHTRQSEGTVSNLE
IPGLKMPRGIAVDWVAGNLYWTDSGRDVIEVAQITGQHRKTLISGMIDEPHAIVVDPQRG
TMYWTDWGNHPKIETAAMDGTLRQTLVHENIQWPTGLAVDYFNERLYWADSKLSVISSVR
LDGSDPVVAVSNLKNNLLRPYSIDIFEDYIYGVTHTNNIVFRVNKFGKGQAENLTTGINH
ATDIVLYHRYKQPEMTNPCDRKKCEWLCLLSPSGPVCICPNDHVPDNGTCVKVQPPDQFP
FSPTCDLQCQNGGSCYLNPLKNPKCRCPTSYRGERCEINQCRDYCQNRGTCSPSRTGAPT
CRCQTGFTGPRCNLYICENYCQNGGNCAVSLGNQPTCRCPPGFLGDQCQYRQCEDFCKND
GQCLELNNGTKHCQCSDKFFGPQCELDKCEYCGTGKCEKLQTGITCKCADNTKRPTCYTC
DDFCIEGQCSVDTYTNLPQCRCHTGWSGFRCELNVAPVQNSDSGNTPSVVIPVMLLLLLA
LLVVAAILWYKKRMRGAKGFQHQRMTNGAMNVEIGNPAYKIYEGEPDDDAGELLDSDFTL
DPDKPTNFTNPVYATLYMGAHNSRNSLASTDEKKELLSAGDDDMGDPLA
NT seq 13650 nt   +upstreamnt  +downstreamnt
atgccatcttgcaatgcaaacatgctggctgttggattgctctacctgggattagttctt
gcactggaggttgtagatcccaccagagccattgaagccccgaagacatgcagtccaaaa
cagtttgtatgcaaagaccaagtaacctgcatctccaaagggtggcgctgtgatggggag
aaagactgtccagacggctctgatgaatctcctgatatatgtcatcacacacaggtgaca
cagtgccctcccaatgagtttgagtgtcgaggaacggatgtgtgcattcacctgagcaag
ctgtgtgacggcgtcccagactgcaccgatggacgcgacgagggcccgcactgtcgagag
cttgctagtaaatgctcaatcatggactgccagtacaactgttcggtgactttgtccggt
ccaaagtgctactgcaagaatggctatgaagtgggagaagatggaaagacatgcaaagac
tttaacgaatgtgccgtgtacgggacttgcagtcagacctgcacaaactcagagggctcc
tacacctgcagctgtgtggagggttacctgccgcaactggacaaccgctcatgcaaggcc
aagaatgacccagtggatcggctcccgttcctccttatagccaactcccaaaacatccaa
gccacctctctgagtggagcaaaccctattaccatcaacgacaaacagaccaccacaatg
gacttcatctacgcccaggagaccgtgtgctggatccacatgggcgactctcccactgcc
tcgcaactcaagtgtgccaagtttcccaatgccaagagctttacggaggagaagaccatt
aacatctccctcagcctgcaccatatggagcagatggccattgactggttgaccggaaac
ttctactttgtggataatgtggatgaccgcatatttgtatgcagtaaagacggctccatc
tgcgtgatcctgttggatatggagctctacagccctaaaggaatcgctcttgaccctgcc
atgggaaaagtgttcttcacagattatggccagaccccaaaagtagagcgctgtgatatg
gacgggcagaaccgcaccaaactagtggacagtaaaatcgtcttccctaacggcatcact
ctggacctggccaacaagctggtgtactggactgatgcttacttagattatattgaggtg
gtggattacgaaggcaagaaccggcacaccatcattcagggcttactgattgagcatctg
tatggtttaacagtgtttgagaactatctgtatgccaccaactctgacaacgccaacatg
caacccaaaaccagcgtcatcagagtcaaccgattcaacagctctgacttccaggtggtc
acgcgtgtggataaaggtggcgctcttcatgtttaccaccagagacgccaacccacagtg
cgcagtcacgcatgtgctctggatccgtttgggaagcctggcggatgctctgatatctgc
cttctggctaacagccacaaaacccgaacctgccgctgccgctctggctttagccttggc
agtgatggaaagtcctgcaagaaaccagagcatgagctgttcctgatctatggtaaaggc
cggcctggagtcatccgtgggatggacatgcattctactgtttatgacgagcacatcgtc
cccattgaaaacctgaataacccgagagcgctggacttccatgcagagaccgaattcatc
tattttgctgatgccacaagctacatcatcggcaggcagaagcttgacggcactgagaga
gacatcatcgtcaaagatggtattcacacagtagaaggtatagctgtggactggatgggg
caaaacctgtactggactgatgatggacccaaaaagaccatcagtgtggccaaactggag
aaagcctctcaaacacgcaaaactctcattgagggcaagatgacccatccgagagccata
gtggtggacccgtctcatggaatgatgtactggagtgactgggaggaggagcctaaggag
atgaatcgtggtagtatcaggaaggcatggatggatggctcaaatgctggtatactgctt
acatctaaaactgtgctctggcccaatggcctcagcctggacatccagcagggtcttctg
tactgggtggatgcatactacgaccgaatcgagatggtgcttctcaacactacagagcgc
aggacggtgtatgaaggacaggagctgaaccacccattcggcctgtgccaccataagaac
ttcctgttttggaacgagtaccgcggtggaggaatctacaagctggaccagaacaccaag
aaagccacactgttacgcaatgaacgaccgccaatctatgaaattcgcacctatgatgca
caacaacagcaaattataggctctaatgtgtgtcgtgctaataatggtggctgcagcagt
ttgtgccttctgacgcccaccggacgatcctgcgcctgtgctgacgaccagatactagac
acagacaacaagacctgcagagcaaatccttcctacgtgcctcctcctcagtgccagcct
ggagagtttgcctgtaagaataaccgctgtattcaagagcgctggaagtgtgatggagac
aacgactgtctggacaacagcgatgagacccccgatctgtgcaaccagcacacttgtcct
gcagaccgctttaagtgccagaataaccgttgtatccctctgcgctggctttgtgatgga
gacaatgactgtggaaatgatgaagacgaatccaacagcacgtgcttggcacgcacatgt
ccttctaaccaatacccatgtgctagcggtcgctgtatccccgtctcctggatgtgtgac
ctggatgatgattgtggagatcgctctgatgaaccagcatcctgtgcgtatcccacctgt
tacccgctcactcagttcacctgtgccaatggacgctgcattaatgtaaattggcgttgc
gataacgataatgactgcggggataacagtgatgaagccggctgcagtcactcgtgctcc
agtgtacagtttaaatgcaatagcggccgctgtattccagagtactggacctgcgatggc
gacaacgactgtggagattacagtgatgagactcacgccaactgtactaatcaggccacg
cggcctcccggcggttgccacacggatgagttccaatgccggatggatggtttgtgtatt
cccatgcgatggcgctgtgatggagacacggactgcatggacctcagcgatgagaagaac
tgcgagggtgtcacgcacatgtgcgatcctgctgttaagtttgcatgcaaggactcagct
cgttgcatcagtaaagcctgggtgtgcgacagggacagtgattgcgaggataactccgat
gaagaaaactgtgaggctctggagtgcaagctctcccatcacgtttgtgccagtaatgac
tccatctgccttcctcctgagaaactgtgtgacgggaaggatgactgccctgatgcctca
gatgagaagctttgtaatctttgcacggtggaaaatggaggctgcagccataactgtacc
atcgctcccggtgagggcgtcctgtgctcctgcccagctggcatggagctgggtactgac
aacaagacctgccagatccagagcttctgcgccaagcatctgaagtgcagccagcgctgt
gtgcaggagaaggccacagtcaagtgtgcttgttatgagggctgggcactcgggcctgat
ggagagagctgcaagagcacggatccattcaagcccttcatcatcttctccaaccgacat
gagatccgtcggattgacttgtacaagggtgagttcagtgtgctggtgccaggactgcgc
aacaccattgccctggacttccacttcaaccagagctccctctactggaccgatgtggta
gaagacaagatctatcggggaaagctgtcagaaaacggagctctgaccagttttgaggtg
gtgatccagtatggtttggccaccccagagggattggcagtggactggattgcgggaaac
atctactgggtggaaagtaacctggatcagatcgaggtggccaagctggatggtaccatg
cgcacaaccttactagctggagaggtggagcatccacgtgccattgcactcgacccaaga
gatggaattctgttctggacagactgggacgcgagctcacccaggatagaagctgcatct
atgagtggggagggtcgtcgcactattcacaaagagactgggattggtggctggcccaac
ggcctcactgttgactacctcgagcgccgtatcctgtggattgatgccagatctgatgcc
atctactctgctgcttatgatggttcgggcctgatcgaggtgctgcgaggtcatgaacac
ttgtctcaccctttcgccgtcaccctgtatggaggagaagtgtactggacagactggcga
accaacactctggcgagggccaacaagtggacgggacacaacgtgactgtagtccagaga
acaaacactcagccgtttgaccttcaagtatttcatccatccagacaacctcaggctccc
aacccatgtgcagcaaatgacgggaagggtccatgttctcacttgtgcctcattaactac
aaccaaacgttctcctgtgcctgtccacacctcatgaagctcaaggcagacaaacacacc
tgctatgagtatcgtcagttcctgctttacgctcgtcagattgagatcagaggggttgac
attgataatccctattacaactacatcatctccttcactgtccctgacattgacaatgtg
actgtggtggattatgatgctctggagcaccgaatctactggtctgatgttcgcacgcag
accatcaaaagagccttcatcaatggcactggtgtggagacggtggtgtctgctgatctc
cctaatgctcagggtctagctgtggactggatctccagaaacctattctggaccagctac
gacaccaataagaagcagatcaacgtagcaaggctggacggttctttcaagaatgcagta
attcatggtcaaggactggacaaacctcactgtctggtgctgcatccgatcctggggaaa
ctttattggctggatggagacaacatcagcatggccaacatggatggcaccaaccacaca
ctgctgttcaccaatcagaaaggcccagttggcttgtccattgacttcgactcagaacaa
ttgtactggatcagctcaaggaacagcaccatcaaccactgtaagatggacggctctggg
ttggaagtcattgaaagcgtgaaaggaaaactcaccaaagctacagccctcgccatcatg
ggagataagttgtggtgggccgatcagagcacagatcagattggtacgtgtgacaagagc
gatggaggcaactggaaggttctgcgatatcacacctcacccatgatgcatatgaagatc
tacaatgaaagcgtgcatcagataggtaccaacctctgcagtaagaacaatggcgactgc
tctcagctttgcttgccaacttcaccctctactagagcctgtatgtgtacggctggatac
agtctgaagagcggccaacaatcctgtgaaggaatgggctcgtttttgctctactctgtg
catgagggcatccgtggcattcctttggacccatcagataaatctgatgccctggtacca
gtatctggtacctctcttgctgtgggcattgacttccatgccgacaatgacaccatctac
tgggttgacatgggcctgagcaccattagccgagccaagagagaccagacgtggagggag
gacattgtgaccaatggcattggacgtgtggaaggaatcactgtggactggatcgcaggc
aacatctattggactgatcaaggctttgatgtaattgaggtggccagactcaacggctct
ttccgctatgtggtcatctctcatgggctggacaaaccacgggctattgctgtacatcca
gagaaagggtatctgttttggacagagtggggtcagtatccacgaattgaaagatctcgc
ctggacggttctgagagagtagttcttgtcaatgtcagcatcagctggcctaatggcatc
tccattgattaccaggagggcctgctgtattggtgcgatgcccgaactgacaaaattgag
cgcataaatctggagactggagaaaaccgtgagctggtgctgtctagtaacaacatggac
atgtttgccgtttctgtctttgaggattacatctactggagtgacaggactcatgccaat
ggctctatcaagagaggaaacaaggataatgccacagatatggtgtatttgagaacaggc
attggtgtacaactcaaagacattaaagtcttcaaccgcgcaaggcagcaaggaaccaac
gtctgtaaggtgaacaacggtggttgtgaacagctgtgtttgttccgtggtaatggaaat
cgcacttgcgcctgtgcacacggcatgttggcagaagatggtcacagttgcagagactac
gacggctacctgctgtactcggagcgcacaatactaaagagcattcacctgtcggatgaa
acaaacctcaacgctcccatcaaacccttcgaggacccagagcacatgaagaacgttatc
gctcttaccttcgactacaggggtggcgggggaaagggagcaaaccgcatcttctacagt
gacattcacttcggtaacattcagcacattaatgatgatggctccgatcgcaagactata
gtggacaatgtaggatcagtggaaggtttggcttatcaccggggctgggacactctttac
tggaccagctacaccacttccaccatcacacgacacactgtagaccaaagccgctctggt
gctttcgacagagatactgtggtgactatgtctggggacgaccatcccagagccttcgtt
ttggatgaatgtcaagacctgatgttctggactaactggaatgaacagtctcccagtatc
atgcgagcatctctttctggtgcgaatgtcctggtgatcattggcaataacatacgcacc
ccgaacggcctggccattgaccaccgagcagagaaactttacttctcagatgccacattt
gacaagattgaacgctgcgagtacgacggcagccgacgctttgtggtgttgaagaatgaa
ccagttcatccgtttggtttggctgtgtatggtgattatatcttctggacggactgggtg
cgcagagctgtgctcagagctgataaatacggtagagacatgaaggtcctgcgtgctgac
attccccaacagccaatgggcatcatcgctgtggccaaagacactaatagctgtgagttt
tctccatgcctcaccaataacggaggctgtcaggacctgtgtctgatcacatctgaaggt
cgagtgaactgcagctgtcgtggagaacgcaaactgctgggagataatacctgtgtggct
gaaaacacaacttgcaacagtgtggatgagtttgaatgtggaaatggcgactgtatcgac
tacagtttgacttgcgactctctggctcactgcaaagacaagtctgatgagaaacaggcc
tactgcgcaaaccgcatgtgtaagaagggctaccggcgctgcattaacggacgctgtatc
aaacacagctcctggtgtgatagcactgatgactgtggggatggttcagatgagctgcca
tgcaacatgactctgtgcagcgctgctgagtttcagtgtaaagacggctcctgcatcact
aactcaagccgctgtaatcaggtggtggattgtgaggacgccagtgatgagatgaactgc
agccccacggactgctccagttactatctgcttggagtaaagggtatgacgtttgagcgc
tgtgagttcactaccctctgcttcgccccctcctggcgctgcgatggctctaatgactgc
ggagacttttcagatgagcgaaactgccctgaaaaaaggcaacagaaatgttcagagaac
aactttgcgtgtccgagcgggcgctgcattcccatgagctggacctgtgacaaagagaac
gattgtgaggatggagcagatgaggctcactgtgaaaagtttttccagttctgtgcatct
aatcagtttgaatgtggaaaccatcgctgtatcttcaaaacctgggtgtgtgacggcact
gatgactgtggcgacggcactgatgaggacagcagatgcaaggcaaagacttgcggtcca
gactctttccagtgtccgggttcccatgtgtgtattcttcagcgctgggtatgtgatggg
gataaagactgccctgatggaggagatgagggacttaaggctggctgtgtgtttaacaag
acctgtgatgacactgagttccagtgtcagaattctcagtgtattcccaaaaacttcatg
tgtgatcatgacattgactgtcgcgatggctctgacgagtcgccagagtgtgaatatcct
acctgtgggccaaatgatttccactgtgcaaatggccagtgcctgaagcagaaaaactgg
gcatgtgatggagagtttgactgtagagaccaatcagacgaagcacccaaaaacttgcaa
tgcacagacacagagagccgctgtaatgacactgcattcctgtgctccagtggcaagtgt
gtgaatgagacattgctgtgcgacaataataatgactgcggtgacggctctgatgaaaac
aactgcttcgtcaacgaatgtctgaatagtaagcttagtggctgctcacagctctgtgaa
gatctgaagatcggcttcaagtgccggtgtaatgcaggtttccgccttaaacaagatggg
aagacgtgtgtggatctggacgagtgctccactgtgtacccttgctctcagcgttgcatt
aacactcatggtagcttccactgcctctgtgttgatggctttgtcccacgtcctgatgac
cacactagctgcaagtccactgctgaggaggaacctttcctcatctttgcgaaccgttac
tacctgagaaaactcaacctggatggttcaaactacacgctgattaaacagggactcaat
aatgcagtggctctggactatcattacgcagaacagatgatctactggacagacgtgacc
acacaaggcagcatgatccggcgcatgcacatcaacggcagtaacgtgcaggtgctgcac
agaacctctctgagtaaccctgacggtctggcggtggattgggtgggaggaaacctgtat
tggtgtgataaaggcagagacactattgaggtgtccaagctgaacggagcttacagaagt
gtgctggtcaacagtggcctgcgggaacctagagctgtggctgtggatgtgagaaatgga
tatctgtactggtcagactggggtgacgtgcctcatattggccgcattggcatggacggc
actgaccgtcaaatcatcattcaagataagatcacatggcctaatggtctgacgcttgac
tttattaatgaccgcatctactgggcagacgctcgtgaagactacatcgctttcgccagt
ctggacgggtccaacagacacactgttctgaaccatgacatccctcacatcttcgccatg
actctgtttgaggagttcatctactggaccgactgggaaaccaagtccatcaacagagct
cataaaaccctgggcaccaacaagactctgttgatcagtaccctacatcgtcccatggac
atccacatcttccacccatccagacagcctgaggtgtctggtcacccgtgtcaggaggac
aacggcggctgcagtaacctgtgtctgctctctcctggagggggatataagtgtgcctgt
cccaccaacttctatctggctgctgatggaaaacagtgcctgtccaactgtactgccagc
cagtttgtctgtaagaatgataagtgcattcccttctggtggaagtgtgatactgaggat
gactgtggagatcgctcagacgagccagctgattgtcctgaatttaaatgcagaccaggt
cagttccagtgcggcacgggtctttgcacaaaccctgcttacatctgtgacggagacaat
gactgtcaagacaactctgatgaggccaactgtgacatccatgtttgcctgcccagccaa
ttcaagtgttcacatcctagtcgctgtattcctggaatcctgcgctgtaacggacagaac
aactgcggtcagggagaagatgagaaggactgtccggaggtgacctgcgctcctaaccag
ttccagtgtgccatcaccaaacgctgtataccccgagtctgggtgtgcgatagagactac
gactgtgtggatgagtctgatgaaccagccaactgcactcagatgaagtgtggtgtagat
gagttccgctgtaaagactcaggccgctgtatcccgtctcgctggacatgtgatggagag
gacgactgcggcgacgcctctgatgaacccaaagaggagtgcgatgagagaacatgtgag
ccttaccagttccgctgtaagaacaaccgctgtgtgccgggccgctggcagtgtgattat
gataatgactgtggcgataactcagatgaggagaagtgtgtgccgcgtcagtgctcagag
agtgagtttgcctgctctaatggccgctgtattgctggaaggtggaagtgtgatggagat
catgactgctcagatggatctgatgaggatggctgtgatctgaagtgtgaggaggatcag
tttcagtgtaagaatggtcactgtattccgctcccctggcgttgtgatgctgatgtggac
tgccttgatggcagtgatgaagagcgctgtgagattactgaggtgcggcactgctccagt
gaggagttccagtgtaataacactctgtgtaaaccactgtcctggaagtgtgatggagag
gatgattgtggagataattcagatgagaaccctgaggcatgcagacacttccagtgccca
ccgactagaaatttccgctgtcgtaataatcgtgtgtgtctcacgagaagcaagctgtgc
gatggagtggacaactgtggagacaactcagatgaggccagctgtgactatgaatccaca
tgtgataaagaccagttcaggtgcaccaatggcaaatgcatcagtgccaacctgcgttgc
aactttttcaacgactgtgaagactacggctctgatgagatcggctgcaagacagacacc
atgctgaacgactgtaagagtaacaaatctctgtgtggagacggcgatgaggctcactgt
gtatctaatggcacagacaccttctgctcctgcaaacctggtttccaaagtgttagacac
aacacctgtgaagataaggatgagtgcaaacagtttggcgtatgttctcatgtgtgtaat
aacaccaaaggctcctacaaatgcagctgccacaaatacttcaccaggattaaccacacg
tgcaaggctgatggtcaaaacagcaataaacaggtgctttatattgcggatgacaatgag
atccgcagtctgaatcctgggatgcccaactgggtttacgagcagacgttccagggcgat
aataacgtccgtatcgatgcaatggatttgcatgtcaaaaccaatcgtattttctggacc
aactggcacacctatggtatttcctgcttccagctgccctctcaatcctcagcgtcaggc
cccacatcaaactctcaccgtcacactagacaaagcgagggcactgtcagcaacctcgaa
attccaggtttgaaaatgccacgtggaattgcagtcgattgggtggctggaaacctttac
tggactgattcgggacgggatgtgattgaggttgctcagattacaggacagcacaggaaa
acattgatttctggcatgattgatgaacctcacgctattgtggtggatcctcagagagga
accatgtactggactgactggggtaatcatccaaagatcgagacggcagccatggacggg
actctcagacaaactctggtccatgagaacatccagtggcctacaggtcttgctgtggac
tacttcaatgagcgtctgtattgggctgatagcaagctttctgtgatcagcagtgtgcgt
ctggacggctctgacccggtggtggcagtatccaacttaaaaaacaatcttctccgcccg
tacagcattgatatctttgaggattacatttatggggttactcacactaacaatatagtc
ttccgggtgaacaagtttggcaaaggacaggcggaaaatctgaccactggcatcaatcac
gcaactgatatagtgctctatcaccgctacaagcagccagagatgacaaacccatgtgat
aggaagaagtgtgaatggttgtgtttgctcagtcccagcgggcctgtgtgcatctgtccc
aatgaccatgtccctgacaatggtacctgtgtgaaggtgcagccgccggaccagttcccc
ttttctcccacctgtgacttgcagtgccagaatggaggtagctgttaccttaacccttta
aagaaccccaaatgtcgctgtcccaccagttaccgcggagaacgctgtgaaatcaaccag
tgcagagactactgtcaaaacagaggaacctgctccccgtctcgcactggagcgcctacc
tgccgctgtcagactggattcacggggcccagatgtaacctgtacatttgtgaaaactac
tgccagaatggaggcaactgcgccgtcagcctgggcaaccagccgacctgccgctgtcca
ccagggtttctgggtgaccagtgccagtatcgtcagtgcgaggacttctgtaaaaatgac
ggtcaatgtttggagctgaacaacggcactaaacattgccaatgctctgataagttcttc
ggtccacaatgtgagctggacaaatgtgaatactgtggcacgggcaagtgtgaaaagcta
caaactggaattacttgcaaatgtgctgataacacgaagcgacccacctgctacacctgt
gatgacttctgcatcgagggccagtgctctgtggacacttatactaatctgccacagtgc
aggtgtcacacaggctggtcaggatttcgctgtgagctcaatgttgcccctgttcagaac
tcagactctggaaatactccatctgtggtcatcccggtgatgttactactcttacttgca
ctgttggtggtcgctgccatcttgtggtacaagaagagaatgcgtggtgctaagggattc
cagcaccagaggatgaccaatggagccatgaatgtagagatcgggaacccggcgtacaag
atttatgaaggagaacccgatgatgatgcaggggagctgctggactcggacttcacactg
gatccagacaagcccacaaacttcacaaaccccgtgtacgccacgctctacatgggtgca
cataacagccgtaactctctggccagcacagacgagaagaaagagctgctgtctgcagga
gacgatgacatgggagacccgctggcgtag

DBGET integrated database retrieval system