KEGG   Danio rerio (zebrafish): 566185
Entry
566185            CDS       T01004                                 

Gene name
caspbl
Definition
(RefSeq) caspase b, like
  KO
K01370  caspase 1 [EC:3.4.22.36]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04217  Necroptosis
dre04621  NOD-like receptor signaling pathway
dre04623  Cytosolic DNA-sensing pathway
dre04625  C-type lectin receptor signaling pathway
dre05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    566185 (caspbl)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    566185 (caspbl)
   04623 Cytosolic DNA-sensing pathway
    566185 (caspbl)
   04625 C-type lectin receptor signaling pathway
    566185 (caspbl)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    566185 (caspbl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dre01002]
    566185 (caspbl)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dre04131]
    566185 (caspbl)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.36  caspase-1
     566185 (caspbl)
Peptidases and inhibitors [BR:dre01002]
 Cysteine peptidases
  Family C14: caspase family
   566185 (caspbl)
Membrane trafficking [BR:dre04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    566185 (caspbl)
Motif
Pfam: Peptidase_C14 PYRIN Adaptin_binding EHN
Other DBs
NCBI-GeneID: 566185
NCBI-ProteinID: NP_001139064
ZFIN: ZDB-GENE-090311-53
Ensembl: ENSDARG00000094433
Vega: OTTDARG00000029771
UniProt: B8A526
Position
1
AA seq 409 aa
MEDITKLITDVLEELVESELKEFKRQLWMGVKKGVEAIPRGKLENKDRQDVVDYMVQHYS
MDAGKIAVQALRSIKQNERANRLESKLLEVQPQAQENEQNPEDPQSINTSGSDELEPIQS
DWQRPRGIINRFQEFKTRLLYANRDDASISIHFYKQNTLSIYTPVSRTQRKGLALLITNI
LFANKQDDRAGAERDEENMEWLLKNLNFMVIKYRNLTGNEISRAVQDFSRRHEHQDADST
FVVIMSHGDRIQNKDAILGVNYNWLQNRNDVYFVEDTFSHLNSVNCPALIDKPKVILIQA
CRGGQLGGVPVKDCVPESDSWVHKEKDFVCFMSTMPDVVAYRDEVKGSYFISYIVDVFCS
SACKDHIMELFRKVAARMEKDERFRRQAKLLPCIERTSLVKKFYLFPGQ
NT seq 1230 nt   +upstreamnt  +downstreamnt
atggaggatattaccaagttgataactgatgtgctcgaggaacttgtggagtcagagctc
aaagagttcaaaaggcagctgtggatgggtgtgaaaaaaggcgtcgaagccattcctcgg
ggaaagctggagaataaggaccgtcaggatgtggtggactatatggtgcagcattacagc
atggatgctgggaaaatcgctgtacaggcactgcgcagcatcaagcagaacgaacgtgca
aatcgcctcgagtcgaaacttctggaagttcagccgcaggcgcaagaaaatgagcaaaac
cctgaagacccgcagtccatcaacacttccgggtctgatgagctagagcccatccagtct
gactggcagagaccacgagggatcattaaccgctttcaagagtttaaaaccagacttctt
tacgcaaacagagacgatgcaagtatttcaatacatttttacaaacagaacacactttca
atttacacaccagtgagcaggactcaaagaaaaggcttggctctgttaatcaccaacata
ttattcgccaataaacaagacgaccgtgccggagcggagagagatgaggagaacatggag
tggctcctgaaaaacctgaactttatggttataaaatacagaaatctcactggaaatgaa
atcagcagagcagtgcaggatttctctcgacgtcatgaacatcaagacgcagacagcaca
tttgtagtcatcatgtcccatggggatagaattcaaaataaagatgccattttaggtgtc
aattacaactggcttcaaaaccgtaatgacgtctactttgttgaagacactttctcccat
ctgaactctgtgaactgtcctgctctgatcgacaaacccaaggttatcctcattcaggcc
tgcagaggagggcaactcggtggtgtgcctgttaaagattgtgtgcctgaatctgactcg
tgggtgcacaaggagaaagactttgtctgctttatgtccaccatgcctgatgttgttgca
tacagggatgaggtcaagggaagttactttatcagctacatagtggatgtgttctgctca
tcagcctgcaaggatcacattatggagctgtttaggaaggttgccgcacgtatggagaaa
gacgaacgtttccgacgtcaggcgaaactcttaccatgcattgaaaggacgtctcttgta
aagaaattctacctgttccctggacagtga

DBGET integrated database retrieval system