KEGG   Danio rerio (zebrafish): 567170
Entry
567170            CDS       T01004                                 

Gene name
pafah1b2
Definition
(RefSeq) platelet-activating factor acetylhydrolase IB subunit beta
  KO
K16795  platelet-activating factor acetylhydrolase IB subunit beta/gamma [EC:3.1.1.47]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00565  Ether lipid metabolism
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09103 Lipid metabolism
   00565 Ether lipid metabolism
    567170 (pafah1b2)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     567170 (pafah1b2)
SSDB
Motif
Pfam: Lipase_GDSL_2 Lipase_GDSL
Other DBs
NCBI-GeneID: 567170
NCBI-ProteinID: NP_001076320
ZFIN: ZDB-GENE-060526-43
Ensembl: ENSDARG00000035352
Vega: OTTDARG00000011443
UniProt: A2BGB4
Position
5
AA seq 228 aa
MSAEENPAAEPAPVTDVQGDGRWMSQHNRFVQECKDAEPDVLFVGDSMVQLMQQYEVWRE
LFSPLHALNFGIGGDTTSNVMWRLQNGELENIRPRVVVVWVGTNNHEHTADQVAGGILAI
AQLLLSRLPKSKMIVLGLLPRGEFPNPLREKNASVNNLLRASLPRLGPIQFLDMGSSFVH
SDGTISSRDMFDYLHLTASAYRTISTTLHELLLQLLEETPQERRASLV
NT seq 687 nt   +upstreamnt  +downstreamnt
atgagtgcggaggagaatcccgctgctgaacctgcacctgtgaccgacgtgcagggtgat
ggacgctggatgtcacagcataaccggtttgtgcaggagtgtaaggatgcagagcctgat
gttctgtttgtgggggactcaatggtgcagcttatgcagcagtacgaggtgtggagggaa
ttgttttcccctctccatgctcttaattttgggattggtggagacacaaccagtaatgtg
atgtggagactacagaatggagaactggagaacatcagaccccgagttgtggttgtatgg
gtaggaactaataaccatgagcacactgcagatcaggttgcaggaggaatactcgctatt
gcacagttacttctgtctcgcctccccaagtccaaaatgattgttttgggcctattgccg
agaggagagtttccaaaccccctgagagagaaaaatgcatccgtgaacaatttacttcga
gcatcgctccctcgactcggccccatacagtttctcgacatggggagtagttttgttcac
tcggatgggactatttcctctcgagacatgttcgactacctgcatctcaccgctagtgct
tacaggaccatttcaacaactctccacgagctgctgcttcaacttctggaggaaacgcct
caggagaggagggcttcactggtttaa

DBGET integrated database retrieval system