KEGG   Danio rerio (zebrafish): 567333Help
Entry
567333            CDS       T01004                                 

Gene name
ctso
Definition
(RefSeq) cathepsin O isoform X2
  KO
K01374  cathepsin O [EC:3.4.22.42]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04142  Lysosome
dre04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:dre00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    567333 (ctso)
  09143 Cell growth and death
   04210 Apoptosis
    567333 (ctso)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:dre01002]
    567333 (ctso)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.42  cathepsin O
     567333 (ctso)
Peptidases [BR:dre01002]
 Cysteine Peptidases
  Family C1: papain family
   567333 (ctso)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C1 CemA
Motif
Other DBs
NCBI-GeneID: 567333
NCBI-ProteinID: XP_021328555
ZFIN: ZDB-GENE-080724-8
Ensembl: ENSDARG00000052855
Vega: OTTDARG00000042819
Position
14
AA seq 242 aa AA seqDB search
MAHSLTFIVLIIYQELLTGIISVEVIWKSLTEGDLQRSDTFQQDVNNELHQRWINYQSSL
QRQAFLNSALGKSNQSAQYGVNQFSYLSQKQFKEQYLTARAEAAPKFDQSKSEIKVKANN
PPRFDWRDHGVVGPVHNQGSCGGCWAFSIVEAIESVSAKVGEKLQQLSVQQVIDCSYQNQ
GCNGGSPVEALYWLTQSKLKLVSEAEYPFKGADGVCQFFPQAHAGVAVRNYSAYDFRLEM
QR
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atggcgcattctttaacatttattgttttgataatttaccaagaactgctcacaggaatc
atcagcgtcgaagttatttggaaatctctgacggagggagatcttcagcgctcagataca
tttcagcaagatgtaaacaatgaactccatcagaggtggattaattaccagagttcacta
cagagacaggcctttctgaactcagctcttgggaaatcaaaccaatctgcccaatatgga
gtaaaccaattctcttacttgtctcaaaagcaatttaaagagcaatatctcacagctagg
gctgaggcagctccaaagtttgaccagtccaagtctgaaattaaagttaaagcgaataat
ccacccaggtttgattggagggaccatggagttgtcggaccagtccataatcagggatcg
tgtggaggatgctgggccttcagtatcgtagaggccattgaatcagtgtctgctaaagtt
ggagagaaactacagcagctcagtgttcagcaggttatagactgttcttatcaaaaccag
ggctgtaatggtggatctccggttgaggctctgtactggctcacacagagcaagctgaag
ttagtgagtgaggcggagtatccgttcaaaggtgcggatggagtctgccagttctttcct
caggctcacgctggagtggcagtgaggaattactcagcttatgacttcagacttgagatg
cagagatga

DBGET integrated database retrieval system