KEGG   Danio rerio (zebrafish): 567406
Entry
567406            CDS       T01004                                 

Gene name
ahsg2
Definition
(RefSeq) alpha-2-HS-glycoprotein 2
  KO
K23409  alpha-2-HS-glycoprotein
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dre01002]
    567406 (ahsg2)
Peptidases and inhibitors [BR:dre01002]
 Peptidase inhibitors
  Family I25: cystatin family
   567406 (ahsg2)
SSDB
Motif
Pfam: Cystatin
Other DBs
NCBI-GeneID: 567406
NCBI-ProteinID: NP_001093499
ZFIN: ZDB-GENE-030131-1133
Ensembl: ENSDARG00000069293
Vega: OTTDARG00000023936
UniProt: A5WWI5
Position
2
AA seq 386 aa
MTEVQHTYIYIQQTKLHSLHSVHSLQEYRFLLFSMQLWATVSVLGLLITGSWAQGVQTTV
NLAECDSPEAEAAALAAQDYLNAQHTHGYKYILNRIEGNKVISRPNHEDTYLMELDFLET
TCHVLDPTPVSLCPVRQQRSTAVEADCDFAVTKGLSIVAFKCKTEIETDDDCLGCPHLLP
LNDTDGLQLIEASLDSFNQNNTLKTKFALFEIGRMTSQIVSGVPQYFAEYAIIGTNCSSY
VDDSCIPQNHTVAIHGLCLAEGSAGLIDVDCKIFNPTQTVHTESNNATMRVQQLLHAHTF
GPQHNPTVHGLRHHKLTALHDPAQSGLISAESTESAEVVAVLPQEAHVVKREVAAPEKPA
VDAKVEKTPILVDPIALSCPGKKKHF
NT seq 1161 nt   +upstreamnt  +downstreamnt
atgactgaagtacagcacacatatatatatattcaacaaacaaagcttcattcacttcat
tctgtacattcgcttcaggagtacaggttcttgctgttcagcatgcaactttgggctaca
gtttctgttcttgggctcctgataacgggttcctgggcgcagggggtacagaccaccgtc
aacttggctgaatgtgattctccagaggctgaagcagcagctcttgcagcacaagattac
ctcaacgctcagcacacccatggttacaaatacatcctgaatcgtattgagggcaacaag
gtcatcagcaggcccaatcatgaagacacgtatcttatggagttggattttctggaaact
acgtgtcacgtcttggatccaacaccagtgagcttgtgcccagtcagacaacagcgcagt
acggcagttgaggcagattgtgattttgctgtgactaaaggcctgtcaattgtggcattc
aagtgtaaaactgagattgaaacagacgatgattgtctaggctgtcctcacctcctgcct
ttaaatgacacagatggactgcaactcattgaagcctctttagatagttttaatcaaaac
aacacactaaagacaaagtttgcactctttgaaattggacgaatgacatctcagattgtc
agtggagtgcctcagtactttgcagaatatgccattattgggacaaactgctcaagttat
gttgatgattcatgcatccctcagaatcacactgttgctatccatggcctatgtctagct
gaaggttcagccggtctgattgatgttgactgcaaaatcttcaaccctacccaaactgtg
cacacagaaagcaacaatgccacaatgcgagtccagcaactactgcacgcccacactttt
ggacctcagcacaaccccaccgttcatggcctcagacatcacaagctgacagcactccat
gaccctgcacaaagtggtttgatctctgcagaatccactgaatcagcagaggtagtagct
gtgctgccacaggaagcccatgttgtaaagcgtgaggtcgctgccccagaaaagccagct
gtagatgcaaaagtagaaaaaacacccattcttgtagacccgattgctctcagctgtcca
ggaaaaaagaaacatttctaa

DBGET integrated database retrieval system