KEGG   Danio rerio (zebrafish): 567438Help
Entry
567438            CDS       T01004                                 

Gene name
cacng3a
Definition
(RefSeq) voltage-dependent calcium channel gamma-3 subunit-like
  KO
K04868  voltage-dependent calcium channel gamma-3
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04260  Cardiac muscle contraction
dre04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    567438 (cacng3a)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    567438 (cacng3a)
   04261 Adrenergic signaling in cardiomyocytes
    567438 (cacng3a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:dre04040]
    567438 (cacng3a)
Ion channels [BR:dre04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   567438 (cacng3a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 Bax1-I
Motif
Other DBs
NCBI-GeneID: 567438
NCBI-ProteinID: XP_021331621
ZFIN: ZDB-GENE-090312-124
Position
1
AA seq 407 aa AA seqDB search
MVSTDARMRVCNRGVQMLLTTAGAFAAFSLMTIAVGTDYWLYSRGVCRTKSVNDNDTNRK
NEEVLTHSGLWRQCCMEGIFKGVCKNIDHFPEDADYEQDAAEYLLRAVRASSLFPIMSVG
LLFIGGVCVAASEFYKSRHNVILSAGIFFVSAGLSNIIGIIVYISSSAGDPNQSESKRSH
WYGWSFYCGALSFIIAETVGVLTVHLFIDTHRVLRARAHRSLQTSTHSLQHRRSFSYRSR
YRWRQGPNRSSDSRSREPSPARQGNDLGLYALGRTLPPSAAHPLAHNSLSSSHGFAHFHN
SVIANNSFANPQTFPMQNSVKSERGLPHIQNSLGPEKGFVGPNAQNSVKAENGVLLSQNY
KRNSVSTGKSVAHLPNSGNDVAHMQNSFKESLFVPQSGTATRRTTPV
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggtgtccactgatgccaggatgagggtgtgtaaccgtggagtgcagatgctcctcacc
acggcgggggctttcgcggccttcagcctaatgaccatcgcggtgggcaccgattactgg
ctgtactcgcgcggagtctgcaggaccaagagcgtcaacgacaacgacacaaaccgcaag
aatgaggaggtgctgacgcattcaggactctggagacagtgctgcatggaaggcatattt
aagggcgtctgtaaaaacatcgaccattttccagaggacgcggattatgaacaagatgct
gcggaatatctgttgcgtgctgtgcgcgcttctagtctcttccctataatgagtgtgggt
ctgctgttcattggtggagtgtgtgtcgctgccagcgagttttacaagagcagacacaac
gtcatcctcagcgctgggatcttttttgtctcagctggcctcagcaacatcattggcatt
attgtgtacatctcctccagcgccggcgaccccaaccagagcgagtccaagcgcagccac
tggtacggctggagcttctactgcggtgctctttccttcatcatagcggagacggtgggc
gtcctgaccgtgcacctgttcatcgacacgcaccgagtgctcagagcgcgggcccatcgc
tcgctacaaaccagcacgcattcactacagcatcgccgctccttcagctaccgctcgcgc
taccgctggaggcaaggcccaaaccgctcatctgactcccggtcgcgtgaaccctctccc
gcccgtcaggggaacgacctcggcctgtacgcgctgggacgaacacttccaccatcagct
gctcacccactcgcgcacaactccctcagctctagccacggcttcgcacactttcataac
tctgtcattgctaataacagctttgctaaccctcaaacattcccaatgcagaactctgtg
aagtcagaaagagggcttccgcacatacagaactcgctgggtccagagaaaggctttgtg
ggtcctaatgcgcaaaattcagtcaaggcggaaaacggagtcttgttgtcgcagaactat
aagcgcaactcagtaagtaccggtaaaagtgtagcgcatctgccgaattcggggaatgat
gttgcacacatgcaaaactcttttaaagagtcattgtttgtgcctcaaagtggcactgcg
acaagaagaacaacaccagtgtga

DBGET integrated database retrieval system