KEGG   Danio rerio (zebrafish): 567792
Entry
567792            CDS       T01004                                 

Gene name
si:ch211-1o7.2
Definition
(RefSeq) ankyrin repeat domain-containing protein 53 isoform X2
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dre03036]
    567792 (si:ch211-1o7.2)
Chromosome and associated proteins [BR:dre03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    567792 (si:ch211-1o7.2)
SSDB
Motif
Pfam: Ank_5 Ank_2 Ank_3 Ank_4 Ank
Other DBs
NCBI-GeneID: 567792
NCBI-ProteinID: XP_009301209
ZFIN: ZDB-GENE-141222-28
Ensembl: ENSDARG00000098445
Vega: OTTDARG00000042336
Position
7
AA seq 191 aa
MSVLRKDNNEAVVGGSPPESDMFHAAASGARDWLSLTLKKARKPLITDKHGLSVLHIAAL
HGHLDCMELLLAGGYADVNVSCPHGRRPLHMMLTAQSQPNTHAGLIYLLEHGAHISVFLK
DAMWRKDKEQQMKRSKHQHNLRQELLMMTKSRGKCVSVLDLPRLGRSGKAMSSPWTEVVL
HLSEELKPGHY
NT seq 576 nt   +upstreamnt  +downstreamnt
atgagtgttcttcggaaggataacaatgaagcggttgttggtgggtctccgccggagagc
gacatgtttcacgcggccgcgagcggagcgcgtgactggttgagtttgacactgaaaaaa
gcgcgaaaaccactgattaccgacaaacacggtctctctgtgcttcatatagctgccctt
catggtcatctggactgtatggagctgctgctggctggaggttatgccgatgtgaatgtc
agttgtcctcatggacgcagacctttacatatgatgctgacggctcagagtcaaccaaac
actcacgccggactcatttacttgctggaacacggagcccacatcagtgtgtttctgaaa
gatgccatgtggaggaaagacaaagagcagcagatgaagagaagcaaacatcagcacaat
ctcagacaggagctgctcatgatgaccaagagcagaggaaagtgtgtcagtgtgctggat
ctgcctcgtctgggtcggtctggaaaagccatgagctcaccctggactgaagtggtcctg
catctgtctgaagagctcaagccgggacactattag

DBGET integrated database retrieval system