KEGG   Danio rerio (zebrafish): 567798
Entry
567798            CDS       T01004                                 

Gene name
agla
Definition
(RefSeq) glycogen debranching enzyme
  KO
K01196  glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00500  Starch and sucrose metabolism
dre01100  Metabolic pathways
Module
dre_M00855  Glycogen degradation, glycogen => glucose-6P
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    567798 (agla)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     567798 (agla)
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.33  amylo-alpha-1,6-glucosidase
     567798 (agla)
SSDB
Motif
Pfam: hDGE_amylase GDE_C hGDE_central hGDE_N Alpha-amylase LINES_C
Other DBs
NCBI-GeneID: 567798
NCBI-ProteinID: NP_001166124
ZFIN: ZDB-GENE-071004-6
Ensembl: ENSDARG00000103811
Vega: OTTDARG00000040985
UniProt: A0A0R4IV67
Position
2
AA seq 1532 aa
MTAKQTRVMVLNDMEKLDRTLFRLDQGFELQFRLGPTLQGKHVRVYTNYPTEGERFDRQK
FHALDWINPTAREDDSDKFCTLDLKISGSYQYYFGHGGDEKSGGGYIVVDPVLRVGADNH
VLPLDCITIQTYLSKCLGPLDEWSDRLRVAKEAGYNMIHFTPLQTLGESRSCYSLADQLE
LNPDFSPSGQTYTWTDAGNLVEKLKNEWNMLCITDVVYNHTASNSKWIKKHPECGYNLVN
SPHLKPAWVLDRALWHVTCAIADGKYEDRGLPALIQDHPHLHAIRGVLWQEVFPKIKLWE
FFQVKIEALVEQFRALLQSAKPDSSKTDGKKQLKIIQDPQYRRFGNTVDMNTALELFVPN
GNSPGAIEDCCNWLRRKLEELNGEQFHEVKHHQEQATNCIDGTVSYERLADHGPKLGPIT
RKHPLVTRYFTFPFEETTLEQDLELINQPEKSCHFLAHNGWVMGDDPLRNFAEPGSNVYI
RRELICWGDSVKLRYGSGPEDCPYLWAHMQKYTEITAKHFVGVRLDNCHSTPLHVAEFML
DAARRLRPDLYVVAELFTGSEELDNVFVTRLGITSLIREAMSAGDSHEEGRLVYRYGGEP
VGAFLQPSLRPLVPSIAHAMFLDVTHDNECPIQIRSVYDSLPSSAIVSMACCATGSTRGY
DELVPHQISVVSEERFYTKWSSQAKPSSPNEVNLQTGIIAGKLALNRLHQELAAKGFSQV
FVDQVDEDIVAVTRHCPSTHQSVVAVCRTAFKNPKHHRYTDEVPPMCIPGKIEEVVLEAR
TVERQTGTYKKDERSINGMPEYTVEIKEHIQLADSKVVRQAGVTSRGRSEYVQEIVFEKL
TPGSVIAFRVSLDPKSQELVGVLRNHLIQFNPLYKAGSVPDSNTPDILKSPLTQIMSKLT
LADMNLLLFRCDSEEKEDGGGCYNIPGWTPLKYGGLQGLLSVMAEIRPKNDLGHPFCDNL
RQGDWMIDYVSNRLVSRGGPLAEVGQWFQAMFAYLKHIPRYLIPCYFDAILVGAFTTALD
ATFRQMSSFVQDGSSFVKLLALGSVQMCGVGRFPALPPLSPALSDVPYRVNEITKEKEQC
CVSMAAGLPHFSAGIFRCWGRDTFIALRGLLLVTGRHLEARNIILAFAGTLRHGLIPNLL
GEGVGARFNCRDAVWWWLQCIQDYCTMVPNGTDILQCPVSRMYPTDDSKPLTAGTVDQLL
YEVIHEAMERHIQGIEFRESNAGPQIDRNMRDEGFNIEAKVNPDTGFVYGGNRFNCGTWM
DKMGESERARNKGIPATPRDGSAVEIVGLCKSTLRWLVELHKKGLFPYNTVKIQRDGKQL
SVAYDEWEMKIQKNFEKMFYVSHDPNDPNEKHPELVHKRGIYKDSYGASSPWCDYQLRPN
FTIAMVVAPELFTVEHAWKALNMAEEKLLGPLGMKTLDPDDMVYCGVYDNSLDNDNYNLA
KGFNYHQGPEWLWPIGYFLRAKIFFAKKMGKDTYDKTVYLVKNVLSRHNVHMERSSWKGL
PELTNENGQYCSFSCETQAWSLAAVLEVLHDL
NT seq 4599 nt   +upstreamnt  +downstreamnt
atgacagctaaacaaacaagagtgatggtcctcaatgacatggagaaactcgacaggact
ctcttccgtctggaccaagggtttgagctccaatttcgtctgggtcccactcttcaaggg
aaacatgtacgtgtttacaccaactaccccacagaaggcgagcgctttgatcgccaaaag
tttcatgcattagactggattaaccctactgcaagagaagatgattcagacaagttctgc
acacttgacctcaagatttcaggctcgtaccagtattattttggccacggtggtgatgag
aagtctggtggtggatatattgtggtggacccagtgctcagggtaggagcagataaccat
gtcttgcccctggactgcatcactattcagacatacctttccaaatgcctcgggcccctg
gatgagtggtcagacaggctaagggtcgccaaagaggcagggtacaacatgattcacttt
acaccactgcagacgctgggtgagtctcgctcctgttactctctggcagatcagctggag
ctcaacccagacttctctccttcgggacaaacgtacacctggacagatgctggcaacctg
gtggagaagctaaagaatgagtggaatatgctttgcatcacggatgtggtttataatcat
acagcttctaacagcaaatggattaagaagcatccagagtgtggttataacctggtaaac
tctcctcatctgaaaccggcctgggtgctggacagagccctgtggcacgtcacctgtgct
atagctgatggcaaatatgaagatcgtggtctgccagctctcatccaggatcacccacac
ctccatgccattcgaggagttctctggcaggaggtgtttcccaagatcaaactgtgggaa
ttcttccaagttaaaatagaggcgctggtggagcagttcagagctttacttcagagcgcc
aaaccagacagcagcaagactgatggcaaaaagcagctgaagatcattcaagaccctcag
tacagacgctttggtaacacagtggacatgaacacggctctagaactctttgtgcccaat
gggaacagtcctggtgccattgaagactgctgtaattggctaaggaggaaactggaggaa
ctcaatggggagcagtttcatgaagtaaagcaccaccaggagcaggctactaattgcatt
gatggaacagtaagctatgagagactggctgaccatggacccaaactgggccccatcacc
aggaaacatccactggttaccagatatttcactttcccattcgaggagacaactttggag
caagatctggagctgattaatcaaccagagaagtcctgtcacttcctggcccacaacggg
tgggtcatgggggacgatcccttgaggaacttcgctgagccaggctccaacgtctacatc
aggagggagctgatctgctggggcgacagcgttaaactgcgctatggcagcgggcccgag
gactgcccctacctgtgggcccacatgcaaaaatacaccgaaatcactgccaagcacttt
gtgggagtgcgtctggacaactgccattcaactccactgcatgtggctgagttcatgctg
gatgccgcccgtagactcaggcctgacctgtatgtggtggctgagctcttcactggcagc
gaggagctggataatgtctttgtgactagattaggaatcacttcacttatcagagaggcg
atgagtgcaggagacagtcatgaggagggcaggctggtctatcggtatggaggagaacca
gtgggagcttttcttcagcccagtctcaggcctctggtgcccagcattgcccacgcaatg
tttctggacgtcacacatgacaacgagtgccccattcagatccgctctgtgtatgattcg
ctgcccagctctgctattgtttccatggcctgctgtgccactggcagcaccagaggatat
gatgagttggtgccacaccagatctcagtggtatctgaggagcgtttctataccaagtgg
agttctcaagccaagccctcgtctcctaatgaggtcaacctgcagacaggaatcattgct
ggaaagctggctctcaatcggctacaccaggagctggcagctaaaggcttcagccaggtg
tttgtggaccaggtggatgaggacattgttgcagtgactcgtcattgtcccagcacacac
cagtcagttgtggctgtgtgtcgcactgcgttcaagaaccccaaacaccatcgctataca
gacgaagttccaccaatgtgcattccaggtaagatagaggaggtggtgctggaggcgcgg
accgtggagaggcagacgggcacctacaaaaaagatgagaggagcattaatggcatgcct
gagtacacggtggagattaaagagcacatccagctggcagacagtaaggtggtccgtcag
gctggagtgacgtctcgaggtcgcagcgaatacgtgcaggagattgtgtttgagaagctg
acacctggaagcgttattgccttcagggtgagtctggaccccaaatcccaggagctggtt
ggtgttttgagaaaccatctcattcagtttaatcctctgtataaagcaggaagcgtgcct
gattcaaacacacctgacatactgaagagtccgctgacacagattatgtctaagttgact
ctggccgatatgaatcttctgctgtttcgttgtgattcagaggaaaaagaagatggaggc
ggctgctacaacatccccggctggacaccacttaaatacggtggtttacaaggtctgttg
tcagtgatggcagagattcgacccaaaaatgatcttggccacccgttctgtgacaaccta
aggcaaggggattggatgatagattatgtgagcaatagattggtgtctcgcgggggcccg
ctggctgaggtgggtcagtggtttcaggctatgtttgcttacttgaagcacattccccgc
tacctcattccctgttactttgatgccatcctggttggggccttcaccactgcccttgat
gccactttcagacagatgtcaagttttgtgcaagatggctcatcttttgtcaagttgctg
gctctgggatcagtccagatgtgtggtgttggacgtttcccagctcttccacctctctcg
ccagccctaagcgacgtgccttaccgggtcaatgaaatcactaaggaaaaggagcagtgc
tgtgtctctatggcggcaggcctgccgcatttctccgccggaattttccgttgttggggc
agggataccttcattgccctgcgaggactactactggtcaccggccgtcaccttgaggcc
aggaacatcatcttggcctttgctggcacattgagacatggcttgatccccaacctgctg
ggtgagggggtaggggcccgctttaattgtcgtgatgcagtgtggtggtggctacagtgc
attcaggactactgtaccatggtgcccaatggtactgacatccttcagtgccctgtgtcc
cgaatgtaccccactgatgactcgaagcccctgacagctggcactgtggatcagctactg
tatgaggttattcatgaggccatggagcgccacatacagggtatagagttcagagagagc
aatgccggaccacagattgatcgtaacatgagagacgaaggtttcaatatagaggccaag
gtgaaccctgacactggctttgtgtatggtggaaatcggttcaactgtgggacctggatg
gacaaaatgggagagagtgagagggcccgcaacaaagggataccggctacacccagagat
ggatcagcggtggaaattgtgggtctgtgcaaatctaccttacgctggctggtggagctc
cataaaaaagggctctttccttataatactgtgaaaatacagagagacgggaaacagctc
tctgtggcctatgatgaatgggaaatgaaaatccagaagaactttgagaagatgttctat
gtgtctcatgacccgaatgaccctaacgagaagcatcctgagctggtccataagcgtggc
atttacaaagacagctatggagcctccagcccctggtgtgattaccagctcagacccaac
tttaccatagccatggtggtggctccagagctgtttactgtggagcatgcctggaaagcg
ctgaacatggcagaagagaagctgctcggacctcttgggatgaagactttagacccagat
gacatggtttactgtggcgtttatgacaattcgctggacaatgacaactacaacctcgcc
aaaggcttcaactatcatcagggccctgagtggctgtggcctattggatactttctccgc
gcaaagatcttctttgcaaagaaaatgggcaaagacacttatgacaaaactgtgtatttg
gtgaagaatgttctctctcgccataatgtccacatggaaagatcatcctggaagggtctt
ccggagctcactaatgagaacgggcagtactgctccttcagctgtgaaactcaggcctgg
tctctcgccgcagtgctcgaggtgcttcatgatctgtga

DBGET integrated database retrieval system