KEGG   Danio rerio (zebrafish): 567938Help
Entry
567938            CDS       T01004                                 

Gene name
pik3c2b
Definition
(RefSeq) phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta
  KO
K00923  phosphatidylinositol-4-phosphate 3-kinase [EC:2.7.1.154]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00562  Inositol phosphate metabolism
dre01100  Metabolic pathways
dre04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    567938 (pik3c2b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    567938 (pik3c2b)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.154  phosphatidylinositol-4-phosphate 3-kinase
     567938 (pik3c2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_C2 PI3K_rbd PX C2 DUF4135 Ist1
Motif
Other DBs
NCBI-GeneID: 567938
NCBI-ProteinID: XP_003199535
ZFIN: ZDB-GENE-050309-145
Ensembl: ENSDARG00000086927
UniProt: F1QWN6
Position
11
AA seq 1587 aa AA seqDB search
MSAAQTQNDREQRWGCLESLGLSQKELVLAEALQMEYDALARHRQDKGTSSTLPPDSSKS
SPSRSESSLPRRVPSPSWNNLQQQGVSGSDPMLNHVQPGVSNLSRSSGESHGFTKEPRYI
LDEWESDFKGTSQMLSKGLPTLDEPPPPVPPRNPIPQNDPFIVHRSSAPRDVNLFTPEVD
QPKLSFGETLNYDNLNDSLSKINGDWLSPGRSRRANGDKSGKAVARSNTLPPQIPPRTYL
PTPKSTRSQRRVSVDPVSLGSRPNGFGYELFQVSEERDEEVAAFCHVLDLLRSAYPCNDY
SKNSGFVWSPCVAQDELQQGLGVSIKVTVYSDHFREPLTFSCDGSSTIDLLIYQTLCYAH
DDLDMIDVDDYLLKICSQAEFLKNTQTLASFEYIQQCLKFDWDIRLILTKRSSVNMELAR
TTEDDDTPSTMNHSILLQERPIKQTVTKEALTLLLDTFHNEAESFLLSEVELPLHVERLV
QSVKALCTSLAAVETPDITAALNQLPACPCRLQPKVQKDVSVLAKKENRVAIVEKLTAAI
LDLVELYCSTFNANFHTMPHSSRSTAPIQEAGMVTNVLSFSVYAAHRVPITWAASYENFF
LSCSLTHGGVELCAPQHTSKQSVSKYLFHLVVWDQRVCFPVQINQLPRESQLTVTLYATP
LPPPGGAEEKSKQKRSIESLGWVTMPLFNFRHVLTCGRKLLGLWPSTPGSGNARSSTPNF
SQPDSVILQVDFPTSSFEVRFSTPAPAEFSPQYEFSHLDQVSQRQLHDVLHKKSLFWLSP
EDRRLLWEKRYFCHVEASRLPLVLASAPSWEWACLPDIYALLRQWGCMNHLDALGLLNAT
FPDQECRRTAVQWMDSISDPELLDFLPQLVQALKYECYLDSHLVRFLLRRAIGDVRIAHY
LFWLLKDTLQDSQFSVRYQYLLAALLCCSGRGLREEFDRQCWLVNVLAKVAQRVREASPS
SRQAILREGLDDVKQFFSINSSCRLPLNPGLLVKGINIQSCSYFNSNAVPLKLSFQNQDH
LGDNINVIFKAGDDLRQDMLTLQIIRIMNKIWVQEGLDMRMVIFRCFSTGRGRGMVEMIP
SAETLRKIQVEHGVTGSFKDRPLADWLQKHNPTEEEYEKAVENFIYSCAGCCVATYILGI
CDRHNDNIMLKTSGHMFHIDFGKFLGHAQMFGNIKRDRAPFVFTSDMAYVINGGDKPSSR
FHDFVDLCCEAYNRIRKHAHLFLNLLGLMLSSGIPELSDVDDLKYVYDALRPHESEADAT
MHFTRLIESSLGSVATKLNFFIHNLAQMKFASSEERPVLSFAPRVYTMKTDGVIRSLFVC
RHIKTYSPSKGYSYVVKVEREGQQGSPTLVQRTFEEFNELHSKLQLIFPSSKLPSFPSRF
VIGRSRGEALADRRKDELNGYVWHLIHAAQEVAQCDLIYTFFHPLPRDERAGSVGNVVNT
LHKPTDVSWAPVPGAMAGEVKLSVLYKSDKLFIMVMHIRGLQPLQDGTDPDPYVKLYLLP
DPQKTSKRKTKAARRTCNPTYNEMLVYDKIPRGDLQQRTVHLRVLSEGAFWENTLLGETI
IHLKDLTPGHRWVDWHQLGTRGSDTNR
NT seq 4764 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcagcgcagactcagaatgaccgggagcagcgctggggctgtctggaatcgctc
ggcctcagccaaaaggagctggtccttgcagaggccttgcaaatggagtatgacgccctt
gcccgtcatcgacaggacaagggcacatcaagtacgcttcctccggacagcagcaaatca
tcgccctcacggagcgagtcgtctctgcctcgacgtgttcccagtccctcttggaataat
ttacagcagcagggcgtttccggatctgaccccatgctgaaccacgttcaacccggggtg
tcgaacctatcccgatccagcggcgaatcccatggattcacaaaggagccgaggtatatc
ctggacgaatgggaaagcgatttcaaaggaacatcgcaaatgttgtcgaaaggtcttcca
actctggatgagcctcccccaccggtaccgcccagaaatccaatcccccaaaatgatcca
ttcattgtccatagaagttcagcaccacgggatgtcaacttattcactcctgaggtagac
caacccaagctttccttcggagagacgctgaactatgataacctcaatgactccttgagt
aagataaacggggattggctgtcgcctggtagaagtcggagagcaaatggagacaaatca
gggaaggcagtcgctcgcagtaatacacttcctcctcagattcctcctcgcacatatctt
cccacaccgaagagcactagaagccagcgcagagtatctgtagatccggtgtctctgggg
tccaggccaaatggctttggttatgagctctttcaggtgtctgaagaaagagatgaagaa
gttgcggccttctgtcatgtacttgatttgctgcgttcggcttacccttgcaacgactac
tctaaaaattcaggctttgtttggagcccttgtgtggcgcaagatgaactgcagcagggc
ctgggtgtcagcataaaggtcaccgtttacagtgaccacttcagagaaccactcaccttt
tcgtgcgacggatcctcaacaatcgacctgctgatctatcagaccctctgctatgctcac
gatgacctggatatgattgacgtggacgattatctgctcaaaatctgcagccaggcagag
ttccttaaaaatactcagactctggcgagctttgagtacatccagcagtgtctgaagttc
gactgggacattcgcctcattctcaccaaaaggagttctgtcaacatggagctcgcccga
acgactgaggatgatgatactccatccaccatgaaccacagtattctactgcaagagagg
ccaatcaaacagactgtgaccaaggaggcactgacacttctcctagacacttttcacaac
gaggcagagtcttttcttttatcagaggtggagttgccattgcacgtggagcgtttagtg
cagtctgtgaaggccttgtgtacttcactagcagctgttgaaacacctgacatcactgct
gccctcaaccagctgccagcatgtccctgtagactacagcctaaagtgcagaaggatgtc
agtgtcttggccaagaaagaaaacagagtggcaattgtcgagaagttgactgcagccatt
ttggatcttgtggagctgtactgtagtaccttcaacgctaatttccacaccatgccacac
agcagcagatccacagccccaattcaggaagctggcatggtcaccaatgtgctttccttc
agtgtttacgccgctcatcgggtccccatcacgtgggctgccagctatgaaaatttcttc
ctgtcctgttctctcacccatggcggcgtggagctttgtgcccctcaacacaccagtaaa
cagtcggtcagcaaatatctcttccacctggtggtgtgggaccagagagtttgcttccct
gttcagatcaaccagttgccgagggagtcacagctgacagttacgttgtatgccacccct
ttaccaccccctggaggagcggaggagaagagcaagcagaaacgcagcattgaatctttg
ggttgggtcaccatgcctttattcaactttagacatgttctgacctgtgggaggaagctg
ctgggtctctggccttcaactccaggcagtggaaatgctcgctccagtacaccaaacttc
agccagcctgacagcgtcatcctacaggtggactttcctacctcttcttttgaagtgcgc
ttcagcacccctgctcctgctgagttcagtccccagtatgagttctcccacctggaccag
gttagccagagacagctgcatgacgtcctgcacaagaagtcccttttctggttgagtcca
gaggaccggcgtctgctgtgggagaagcgttatttctgccatgtggaagccagtcgtctg
ccgctggttctagccagtgcgcccagctgggagtgggcatgtttgcctgacatctatgcc
ctgctccgccagtggggatgcatgaaccacctggacgcactcggcctgctcaatgccacg
tttccagatcaggagtgcaggcggacggcagttcagtggatggactcaatctctgaccca
gaacttctggactttcttcctcagctggtgcaggcactgaagtatgaatgttatctggac
agtcacctggtgcgttttttgctgagaagagccatcggtgatgtgcgcattgctcactac
ctcttctggttgctgaaagacactctccaggactctcagttcagcgtgaggtatcagtat
ctgctggcggctctgctctgctgctccggtcgtggtttaagggaagagtttgatcgtcag
tgctggctggtcaatgtgctggccaaagtggctcagcgggtcagagaagcgtcaccctca
tccagacaggctattctccgcgaagggcttgatgacgtaaagcagttcttctcgataaac
agcagttgtcgacttccgctgaacccaggcctgctcgtcaagggcatcaacatacagtcg
tgctcctacttcaactctaatgcagtgcccctcaagctgtccttccagaaccaggatcat
ctaggagacaacattaatgtcatctttaaggctggagacgacctgcgacaggacatgctg
acgttgcagatcattcgcatcatgaataagatctgggttcaggaaggacttgacatgagg
atggtcatctttcgctgcttctcaaccggacggggcagaggcatggtagagatgattccc
agtgcagaaaccctgaggaagatccaggttgagcatggagtaacaggttcttttaaggac
cggcctttggcagactggctgcagaaacacaaccctactgaggaggagtatgaaaaggcg
gtggagaacttcatctattcgtgcgctggttgttgtgtggccacatacattctgggcatc
tgtgaccggcacaatgacaacatcatgctgaagaccagcggacacatgttccacattgac
tttggcaagttcctggggcacgcacagatgtttggcaacattaaacgcgaccgggctcct
tttgtgtttacatctgacatggcgtatgtcatcaatggaggtgacaagccatccagtcgt
tttcatgattttgtagatttgtgttgtgaggcctacaatcgcatcaggaaacacgcacat
ctgtttctcaacctgctcggtctgatgctgtccagtggaataccagagctgtctgatgtg
gatgatctgaagtatgtctatgatgcactgaggccacatgaatcagaagctgatgccact
atgcacttcaccaggctaattgagtccagtcttggcagtgtggctactaagctcaacttc
ttcatccataatcttgcccaaatgaaatttgcgtcctctgaagagcgtcctgttctgtca
tttgcaccacgcgtctacacaatgaagactgacggtgtgattcgcagcctgtttgtttgc
aggcacatcaaaacctattctccaagcaaaggctactcttatgttgtaaaagtggagcgg
gaaggtcagcagggctcaccaacattggtccagaggacatttgaggagtttaatgaactt
catagtaaactgcagctcatcttcccttcctcaaaactaccaagcttccccagccgcttt
gtgattggtcgctctcgaggggaggccctggcagacaggaggaaagatgagctaaatgga
tatgtttggcatttgatacatgctgctcaagaggtggcacagtgtgacctgatctacacc
ttctttcaccccctaccaagagacgagcgggcaggaagtgtgggaaatgttgtcaataca
ctacataaaccaacagatgtgtcctgggctcctgtgcctggtgcaatggcaggtgaagtg
aaactgtcggttctctacaagagtgacaagcttttcattatggtcatgcacattagaggc
ttgcaacctttgcaggatggaacagatcctgatccatatgtcaaactgtacctcctacca
gaccctcagaaaaccagcaaaaggaagacaaaagcagccagacgaacatgcaaccccact
tacaatgagatgttggtgtatgataaaataccacgtggcgatttacagcagagaaccgtt
cacctgcgggtactgagtgagggtgcattctgggagaacacgcttctgggtgaaaccatc
attcatttgaaagacctgacccctggccatcgttgggtggactggcatcagcttggcacc
agaggctccgacacaaaccgctag

DBGET integrated database retrieval system