KEGG   Danio rerio (zebrafish): 567941Help
Entry
567941            CDS       T01004                                 

Gene name
e2f7
Definition
(RefSeq) transcription factor E2F7
  KO
K09391  transcription factor E2F7/8
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dre03000]
    567941 (e2f7)
Transcription factors [BR:dre03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    567941 (e2f7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E2F_TDP TrmB
Motif
Other DBs
NCBI-GeneID: 567941
NCBI-ProteinID: NP_001038612
ZFIN: ZDB-GENE-030131-3527
Ensembl: ENSDARG00000008986
Vega: OTTDARG00000007460
UniProt: Q5RIX9
Position
4
AA seq 723 aa AA seqDB search
MQEVKCLTLKDLLGVRTLVNKTGSDDAASMNDHKENICMDRRKMTPLKSESLTAALNGHG
KISSPEITHITPIKLTEKAHPDPWTPTANLKMLINAASPDIRDREMKKTLFKPIENKGKI
AEEEEEEELDDSCQYEALDESERRPSRKQKSLGLLCQKFLALYPDYPESSESINISLDEV
ATCLGVERRRIYDIVNVLESLMLVSRKAKNMYVWHGRSRLPQTLQGLLQAGRDQHYDLLM
DQREGNGLHAVQHVQNAHAASSRRKDKSLRIMSQKFVMLFLVSKTQTVTLDMAAKILIEE
GQEESYDSKYKTKVRRLYDIANVLTSLNLIKKIHMREEKTRKPVFKWIGPGNFQSSSNSD
DLRGQISNSGTERREKMARHSSFQVITAPPVNQRLISSAPSTPHRYSTDEPVDYSRKSGN
NSAVCRLQFGDGVHPSVSPAVPSALASLAMPLQADLMPVPASFSHPLAILPQTPLLMLYS
GNISDGASSLRKRERSEEDDHQTTKCRRRSASIESDTVESESLSSSTRRSPVCSPEGSPW
DEASFGGLHEDDVAASSSKDALLSPHYLYVPNTAGLNSFNFLLPAGHAQGGVPAVAMPYF
VVQSPLIAGAMPTSSTEGAAGFSVPTVLSPAQFVMAGGAYGVTEILQSPEHHGNVPATTS
SPRAEESPKPAQTQTPVTPKEASLGSKSFFETPGAFGSLVNQSAARKRGSAQRRLDIGHT
AAN
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaggtgaagtgtttaacattaaaggatttgcttggtgtcagaacactggtgaat
aagacaggctcagatgatgctgccagcatgaatgaccataaagaaaacatctgcatggac
agaaggaaaatgaccccactgaagagcgagtctctgacagctgctttgaatggacatggg
aagatttccagtcctgaaatcacccacataacccctattaaactcactgagaaggcccat
ccggacccctggacgccaacagcgaatctgaaaatgctgatcaatgctgctagtccagat
atacgtgacagagaaatgaagaaaaccctcttcaaacccattgaaaataaagggaagatt
gcagaggaggaggaagaggaagaacttgatgactcgtgtcagtatgaagcgttagacgaa
tctgaaaggcgacccagtcgaaaacagaagagtttggggcttttgtgtcagaaatttttg
gctttgtaccctgattacccagaatcctctgaaagcatcaatatttccctggatgaagtg
gccacatgcttgggcgttgagagacgacgcatctatgatattgtgaatgtgctggagtct
ctgatgctggtcagcagaaaggcaaaaaacatgtacgtgtggcacggacgctcgcggctc
ccacagactctacagggacttttacaggccggtcgagatcaacactatgatttactgatg
gaccagagggaagggaatggcctgcatgctgtccaacacgtgcagaacgcacacgccgcc
tccagcaggagaaaggataaatcgctccgaatcatgagccagaagtttgtcatgctgttc
ctggtgtccaaaacccaaactgtaaccctcgatatggctgctaagattttaattgaagag
ggtcaggaagagtcctacgacagcaagtataaaactaaggtgcggcgtttgtatgatatc
gctaacgtcctgactagcctgaatctgatcaagaaaattcacatgagagaagaaaagacc
cgtaaaccagtcttcaaatggatcgggcctggaaattttcaaagcagcagcaattcagat
gatttgagaggtcaaatcagcaactccggcactgaacgacgggagaaaatggcacgtcat
tcttccttccaggtcattactgcccctcctgtcaatcaaagactgataagctccgccccc
agcacgcctcacagatattctacagatgagccggtggattactccaggaaaagcgggaac
aacagtgcagtgtgtcgactgcagtttggagacggtgttcatcccagtgttagtcctgca
gttccctctgcactggcgtctctagcgatgcctcttcaagctgatctgatgcccgttcca
gcttcgttctctcacccgctggcaatcctgccgcagacgcccctgctcatgctgtacagc
gggaacatttctgacggtgcctccagcctgagaaagagggagagatcagaggaagacgac
catcagaccacaaaatgcagaagacgctcggcatccatagaaagtgacacagtggagagc
gagagcttgagctccagcaccagacggtctccagtctgctctcccgaaggctctccgtgg
gacgaggcctcgttcgggggtctgcatgaagatgatgtggctgcatccagttccaaagac
gccctcctgtcccctcattacctctatgtgccaaacactgcaggtctgaatagttttaac
ttcctcctgccagcagggcacgcgcagggtggagtgccggccgtagccatgccatatttt
gtggtgcaatcaccactaatagcaggtgcaatgcccacatccagcactgaaggggctgct
ggcttcagtgtgcccaccgttctgtcgcccgcacagtttgtgatggcaggaggagcttat
ggtgtgactgaaatactgcagagcccagaacatcatgggaacgtaccagccacaacatca
tcaccacgagcagaagagagcccgaaaccagcacaaacacagactcctgtgacaccaaag
gaagcatcgctggggtccaaatctttcttcgagacacctggggcatttgggtctctcgtc
aaccaatcagcagctcgcaaacgaggctccgcccagaggaggctggacatcgggcacacc
gcagccaattag

DBGET integrated database retrieval system