KEGG   Danio rerio (zebrafish): 568159Help
Entry
568159            CDS       T01004                                 

Gene name
ago3b
Definition
(RefSeq) protein argonaute-3
  KO
K11593  eukaryotic translation initiation factor 2C
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dre03019]
    568159 (ago3b)
   03036 Chromosome and associated proteins [BR:dre03036]
    568159 (ago3b)
Messenger RNA biogenesis [BR:dre03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     568159 (ago3b)
Chromosome and associated proteins [BR:dre03036]
 Eukaryotic Type
  Gene silencing
   RISC (RNA-induced silencing complex)
    568159 (ago3b)
   RNA interference (RNAi) pathway
    RITS (RNA-induced transcriptional silencing) complex
     568159 (ago3b)
   microRNA pathway
    RISC loading complex
     568159 (ago3b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Piwi ArgoMid PAZ ArgoN ArgoL1 ArgoL2
Motif
Other DBs
NCBI-GeneID: 568159
NCBI-ProteinID: NP_001153500
ZFIN: ZDB-GENE-060503-452
Ensembl: ENSDARG00000063079
Vega: OTTDARG00000014382
UniProt: A3KPK0
Position
19
AA seq 860 aa AA seqDB search
MEIGTTGAVGAAPQFSVPRRPGYGTMGKPIKLLANCFQVDIPKMDVYLYDVDIKPEKCPR
RVNREVVDSMVQHFKVTIFGDRRPVYDGKKSLYTAQPLPVASAGVDLDVTLPGEGGKDRI
FKVTIKFVSLVSWHMLHEVLTGRSTPDPLELDKPISTNPVHAVDVVLRHLPSMRYTPVGR
SFFSSPEGYDHPLGGGREVWFGFHQSVRPAMWKMMLNIDVSATAFYKAQPVIQFMCEVLD
IHNIDEQPRPLTDSHRVKFTKEIKGLKVEVTHCGTMRRKYRVCNVTRRPASHQTFPLQLE
NGQTVERTVAQYFREKYNLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDN
QTSTMIKATARSAPDRQEEISRLVRSANYNSDPFVQEFQFRVRDEMAEVTGRVLPAPMLQ
YGGRNRTVATPSHGVWDMRGKQFHTGVEIKMWAIACFATQRQCREEVLKGFTDQLRKISK
DAGMPIQGQPCFCKYAQGADNVEPMFRHLKNTYAGLQLIIVILPGKTPVYAEVKRVGDTL
LGMATQCVQVKNVVKTSPQTLSNLCLKINVKLGGINNILVPHQRPSVFQQPVIFLGADVT
HPPAGDGKKPSIAAVVGSMDAHPSRYCATVRVQRPRQEVIQDLASMVRELLIQFYKSTHY
KPTRIIFYRDGVSEGQFRQVLYYELLAIREACISLEKEYQPGITYIVVQKRHHTRLFCAD
RAERVGRSGNIPAGTTVDTDITHPYEFDFYLCSHAGIQGTSRPSHYYVLWDDNCFTADEF
QLLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVDKEHDSAEGSHVSGQSNGRDP
QALAKAVQIHHDTLRTMYFA
NT seq 2583 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcggaactacaggagccgttggggctgcgccccagttctccgtacctcggagg
cctggctatggcaccatggggaagcccatcaagctgctggccaactgctttcaggtggac
atccccaagatggatgtctacctgtacgatgtggacatcaagccagaaaagtgcccacga
cgtgttaacagggaagtggtggattctatggtgcagcactttaaagtgacaatctttggg
gacagaagaccagtttatgatggcaagaagagcctttacactgctcagcctttaccagtg
gcctcagcgggggtggacctggacgtgaccttgccaggtgaaggtgggaaggacaggatt
ttcaaggtaaccattaaatttgtgtcgctggtcagttggcacatgctgcatgaggtcctc
actggacggagcactcctgatcctctggagcttgacaagccaatcagcaccaatcccgta
cacgccgtagatgttgtcctgcgccatctgccatcaatgaggtacacccctgtgggaagg
tcgtttttctcctcccctgagggctatgatcacccactgggcggggggagggaggtgtgg
tttggcttccaccaatcagtgcgaccggctatgtggaagatgatgctcaacattgatgtg
tctgccactgctttctacaaagctcagcctgtgattcagttcatgtgtgaggttcttgat
atccacaacatcgatgagcagccccgtcctctcaccgattcccacagagtcaaattcacc
aaagagatcaaaggtttaaaggtggaggtcacccactgtggcaccatgaggaggaagtac
agggtgtgtaatgttactcgtcgaccagctagccatcagacgtttcctctacagctagaa
aatggacagactgtggagagaacagtggcacaatatttcagggaaaagtacaacttacag
ctcaagtacccccatttgccctgcctgcaagtgggacaggagcagaaacacacataccta
cctttagaggtgtgcaacatagtggcaggtcaacgctgcataaaaaaactgaccgacaac
caaacctccaccatgatcaaagccacggcccgctccgcaccggacagacaagaggagatc
agcagactggtgcgcagtgccaactataattcagacccatttgtgcaagagttccagttc
cgtgtgcgggacgagatggcggaggtgacgggtcgagttctgcccgcccccatgctgcag
tacggcggcaggaatcgtactgtagccacccctagtcatggagtgtgggacatgagaggc
aagcagtttcacactggagtggagatcaagatgtgggccatcgcttgctttgccactcag
agacaatgtagagaggaagttctcaagggctttacagaccagctgcggaagatctccaag
gatgcagggatgcctattcaggggcagccgtgcttctgcaagtatgctcagggagcagat
aatgtggagcccatgttccggcacctgaagaacacttatgctggtcttcaactcatcatc
gtcattctgcctggaaaaactccagtctacgccgaagtgaaacgtgttggagacactctt
ctgggaatggccactcagtgcgttcaggtgaagaatgtggtaaagacgtctcctcagacc
ctttccaacctctgtttgaagatcaacgtcaaactgggcggcattaacaacatcctagtg
ccccatcagcggccttctgttttccagcagccagtcatatttctgggagctgatgtcact
catccgcctgcaggagatggcaagaaaccctccattgcagctgtggtgggtagcatggat
gctcaccccagcagatactgcgctaccgtccgtgtccagaggcccagacaggaggtgatt
caggacctggcatccatggtgcgagagctgctcatccagttctacaagtctactcactac
aaacccaccagaatcatcttctatagggatggagtgtctgaggggcagttcagacaggtg
ctgtattatgagctcctggccatacgtgaagcttgtatcagccttgagaaggaatatcag
cctggaatcacctacatcgttgtgcagaaacgtcaccacactcgccttttctgtgctgac
cgtgctgagagggttggccgcagtgggaacattccagcaggaaccacagtggacaccgac
atcacccatccatacgaatttgacttttatctgtgcagtcatgctggaatacagggtaca
agccgaccttcacactactacgtgctatgggacgacaactgcttcacagctgatgagttc
cagctcttgacgtaccagctgtgccacacatacgtgcgctgcactcgctccgtctccatc
cctgcaccagcctactatgctcatctggtggccttcagagcccgttatcatttagtggat
aaagagcatgacagtgcggaaggcagccatgtgtcgggtcagagtaacggtcgagaccct
caagccctggccaaagctgtgcagatccatcacgacactctgaggaccatgtactttgcc
tag

DBGET integrated database retrieval system