KEGG   Danio rerio (zebrafish): 568334Help
Entry
568334            CDS       T01004                                 

Gene name
usp11
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 11
  KO
K11835  ubiquitin carboxyl-terminal hydrolase 4/11 [EC:3.4.19.12]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     568334 (usp11)
Peptidases [BR:dre01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   568334 (usp11)
Ubiquitin system [BR:dre04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    568334 (usp11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1 DUSP Ubiquitin_3 USP7_C2 zf-MIZ CW_binding_1 RNA_pol_Rpb5_N
Motif
Other DBs
NCBI-GeneID: 568334
NCBI-ProteinID: XP_002663119
ZFIN: ZDB-GENE-081104-421
Ensembl: ENSDARG00000076303
UniProt: F1QPF4
Position
8
AA seq 990 aa AA seqDB search
MAANCSAGSATEPPGLETQWREIDNLNQQQLRAGDSWYLLDKRWYDQWKEYVDTGDQNST
SYPGKIDNTELYEDLDSYRLKERLTENDDFILVPAEAWRKLLSWYDMMDNQPPLERKVVD
LPSTVKVEVYPVEIYLCLSSNLESTVTAQFSRADKIHAIHQKIRQHFDVSETAESRLWMR
SVDTSSERLRNLNMTVLDSCLSSGMTVIMEIRNADGTWPTSRPQIMRNSADEDSYRGPPG
VCGLTNLGNTCFMNSALQCLSNTPPLTEYFLKNLYLEELNFSNPLGMKGEIAEAYADVIK
QMWSGRHYSVVPRVFKTKVGHFASQFLGYQQHDSQELLSFLLDGLHEDLNRVKKKEYIEL
RDADGRPDQEVAEEAWRNHLRRNDSVIVDTFHGLFKSTLVCPECNKVSVTFDPFCYLSVP
LPVSKERVMEVFYVSLDPTAKPTQYRLIVPKAGRVLDLCTALSQATGVPPNQMTVTDVFN
HRFYRIYQSDESLSCILDRDDIFVYQLSSGCVDEDSDEVVLSIYMRERSHYRDYGSGSNS
YGTSLFGHPLRMSVPRAHCTPEHLYQLLLERLARYVRPLDPSEEVEEEEEDDEEELYKAQ
TNGVSDDEGEEDSEEAGSSKKEEEPRASNEVNEQNNGQSEASPSSEGEERAEEEESSSEQ
ERGSSTEEGQSACGSTDTTDGDQSAGAEPSGKEEDEDEEEEDGEEAASCTPANKRHPGRR
RYTERRKKALFTIQAVNSNGTTERGMAEAGGSISFSSQPYIAIDWDPDMKKKYYNENEAE
KYIKHQSMDVPHQQTTVQLQECIELFTTVETLEEENPWYCPTCKRHQLATKKLDLWSLPE
VLIIHLKRFSYTKYSREKLDTIVEFPLRDLDFSGFLLKKTVNSTEPPCPYDLISVSNHYG
GLRDGHYTSYARNKDNGQWYYFDDSKVTYAREEQIVTSAAYLLFYQRQDKIRQPSVPPPV
PCSTQPENHISSQTNDSADGASACVSMETD
NT seq 2973 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgaactgcagcgccggttcggccacagagcctccgggactcgagacccaatgg
cgggagatcgacaacctgaaccaacagcagctccgggccggggacagctggtatttgttg
gacaagagatggtatgatcagtggaaagagtatgtggacactggggaccaaaattcaacc
tcctatcctggaaagattgataacacggagctgtacgaagatctggattcctatcgcctg
aaagaacgactgacagagaatgatgactttatcctggtcccagcagaagcctggcgtaaa
ctcttgtcgtggtatgacatgatggacaatcagcctcctttggagagaaaggttgttgat
cttcccagcactgttaaagtcgaggtctatcctgtggagatctacctctgtctctctagc
aatttggagagcactgtaactgcacagttcagtcgagctgacaaaatacatgctatacat
cagaagattcgacagcattttgacgtgtcagaaactgctgagagccgattgtggatgagg
agtgtggatacaagctcggagaggctacgaaacctgaacatgactgtcctagactcctgt
ctcagctccggcatgacggtgattatggagatcaggaatgcggatggtacgtggcctacg
tccaggcctcagatcatgcgtaactctgctgatgaggactcgtatcgagggcctcctgga
gtgtgtggccttacaaacctgggcaacacctgcttcatgaactccgctttacagtgtctg
agtaacacgccgccactgaccgagtacttcctgaagaacttgtatttggaggagctgaac
ttcagcaaccctctgggcatgaagggggaaattgcagaggcgtacgcagacgtcatcaaa
cagatgtggtcaggaaggcattattctgtggttcctcgggtatttaagacaaaagtgggc
cattttgcatcacagtttctgggttaccagcaacatgactctcaagagctgctgtcgttc
ctgttagatggtctgcatgaagatctcaaccgcgtcaaaaagaaggagtatattgaactc
agagatgctgacggcagacctgaccaggaagtggcagaggaagcgtggcgtaaccatctg
cggcgcaacgattcggtcatcgttgacacttttcacggcttgttcaaatcaactctggtc
tgccccgagtgcaataaggtctccgtaacctttgaccccttctgctacctgagtgtgccc
ttacctgtcagcaaggagagggtcatggaggtcttctatgtctcactggatcccacagcc
aaacccacacagtaccgtctgattgttcctaaagcgggccgagtgcttgacttgtgcact
gctctctctcaggctacaggcgtcccacccaaccagatgacggtgacagacgtcttcaat
caccgcttctataggatttaccaatcggatgagtccttgagctgtatactggaccgggac
gatatatttgtgtatcagctgagcagtggctgtgtggatgaggacagtgacgaggtggtt
ctgtccatctacatgcgcgaacgctctcattacagagattacggctccgggagcaacagc
tatggcacgtctctgttcggtcatccgctgcgcatgtctgtgccacgagcccactgcaca
ccagaacatctctaccagctcctcctggaaagactggcgcgttatgtccgtcctcttgac
ccctcagaggaagtagaggaggaagaggaagatgatgaggaagagctgtacaaggcacag
accaatggagttagtgatgatgagggagaggaagattctgaggaggcggggtcatccaag
aaagaggaggagcctcgggcgagcaatgaggtcaacgaacagaacaatggccaatcagaa
gccagcccgagcagcgagggggaggagcgagctgaggaggaggagtcgagcagtgaacaa
gagcggggcagcagtacagaggagggccaatcagcatgtggcagcactgacaccactgac
ggcgaccaaagtgcaggagcagaaccttcaggaaaagaagaggatgaagatgaggaggag
gaagacggggaagaagccgcatcctgcacgccagccaataagaggcatccgggtagaaga
cgctacactgagagacgaaaaaaagccctttttaccattcaggcagtgaactctaatggc
accacagagagaggaatggcggaggcgggtggcagcatctctttcagctctcagccatac
atcgccatcgactgggatcctgacatgaagaagaagtactacaatgagaatgaagccgag
aaatatataaagcatcaaagcatggatgtacctcaccagcaaacaacagttcagctgcag
gaatgtatagagctctttaccaccgtagagacactggaggaggaaaacccttggtattgt
cccacatgtaaaagacatcagctcgccactaagaaattggatctctggtctttgccggag
gttcttatcatccatttaaagcgattctcctacaccaaatactctcgagaaaaactggac
acaattgtggagttcccattgcgggatttggatttctcaggtttcctcttaaagaagaca
gtgaacagtactgaacctccctgtccatatgacctgatctctgtgtccaaccactacggc
ggactccgagacggacactatactagttatgcccggaacaaggacaacggccagtggtat
tactttgacgacagcaaggtgacctatgcaagagaagaacaaatcgtgacaagcgccgcc
tacctcctgttctaccagcgccaagacaagatccgacagcctagcgtccctccgcccgtg
ccctgctccacccagcctgagaaccacatctcctcccagaccaacgacagcgcagacgga
gcttcggcctgcgtcagcatggagacggactga

DBGET integrated database retrieval system