KEGG   Danio rerio (zebrafish): 568631
Entry
568631            CDS       T01004                                 

Gene name
slc4a4a
Definition
(RefSeq) solute carrier family 4 member 4a
  KO
K13575  solute carrier family 4 (sodium bicarbonate cotransporter), member 4
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dre02000]
    568631 (slc4a4a)
Transporters [BR:dre02000]
 Solute carrier family (SLC)
  SLC4: Bicarbonate transporter
   568631 (slc4a4a)
Motif
Pfam: HCO3_cotransp Band_3_cyto PTS_EIIA_2 VWA_N
Other DBs
NCBI-GeneID: 568631
NCBI-ProteinID: NP_001030156
ZFIN: ZDB-GENE-060526-274
Ensembl: ENSDARG00000013730
UniProt: Q3ZMH2
Position
5
AA seq 1082 aa
MSAGKRVEDEAVLDRGASLLKPLCDQEEVEGHHTIYIGVHVPKSYRRRRRRRRRTSHKDR
KEKVSENTSDRSDAENNEEASNSILKPLISPAAERIRFILGEDDDSPAPPQLFTELDELL
SVDGQEMEWKETARWIKFEEKVEKGGERWSKPHVATLSLHSLFELRTCIEKGTIMLDLEA
STLPGVVEMITDSQIESGLLKADLKEKVMYTLLRKHRHQTKKSNLRSLADIGKTVSSASR
LFSTPDNGSPTTAHRNLTSSSLNDISDKPEKDQLKNKFMKKLPRDAEASNVLVGEVDFLD
SPFVAFVRLQQAVMLGALTEVPVPTRFLFILLGPKGKAKSYHEIGRAIATLMSDEVFHEI
AYKAKDRQDLLAGIDEFLDEVIVLPPGEWDPAIRIEPPKSLPSSDKRKNMYAGGDSTQMN
GDTPHSGGHGGGGHAVGDELKKTGKFCGGLILDVKRKVPFFFSDFYDSLHIQSLSAILFI
YLGTVTNAITFGGLLGDATENMQGVPESFLGTVVTGAVFCLLAGQPLIILSSTGPVLVFE
RLLFNFSRENDFDYLEFRLWIGLWSAFFCLVLVATDASFLVQYFTRFTEEGFSSLISFIF
IYDAFKKMLKLAHYYPINSDFKIDYVTQYDCMCMAPTDANSSDVYTDPLDSTFVWTVNYT
TDPRMNATWSSLSKKECLKYGGELVGKACEFVPDITLMSFILFFGTYTCSMCLKKFKTSP
FFLTTVRKLISDFAIILAILIFCGVDALVGVETPKLIVPSEFKPTSPNRGWFVPPFGGNP
WWVYLAASVPALLVTILLFMDQQITAVIVNRKEHKLKKGAGYHLDLFWVAVLLAVCSFMG
LPWYVAATVISIAHIDSLKMETETSAPGEQPKFLGVREQRVTGVMVFILTGISVFMSPVL
KFIPMPVLYGVFLYMGVASLNGVQFMDRLKLLLMPAKHQPDLIYLRHVPLRKVHLFTFVQ
LLCLALLWVLKSTVAAIIFPVMILALVAVRKALDYIFSQHDLSFLDDVIPEKDKKKKEDE
KKKKKKKQGSIDSDMEDSDYPYNENVPSIKIPMDMMEQEPFLGDKASDREKSASILDRYS
SC
NT seq 3249 nt   +upstreamnt  +downstreamnt
atgagcgccggcaagagggtggaggatgaggccgtgctggaccgaggggcatcgctgctc
aaacccttgtgtgatcaggaggaggttgaaggtcaccacaccatatacatcggtgtgcat
gtgccaaagagctaccggcgacggagacgtcgtcgccgacgcaccagtcacaaggacaga
aaggagaaagtgagcgagaacacttcggacaggtcggatgcagagaacaatgaggaggcc
agcaacagcatccttaaaccactcatttcacctgctgccgagcgcatacgattcatcctg
ggtgaggacgatgacagtcctgcgcctcctcaacttttcacggagctggacgagctgctg
tcggtggacggacaggagatggaatggaaggaaaccgccaggtggatcaagttcgaagag
aaggtggaaaaaggtggagaaagatggagtaaaccacacgtggccactctgtctttgcac
agtctctttgagcttaggacgtgtatagagaagggcaccatcatgctggatctagaagcc
tccactctgccaggggtcgttgaaatgatcactgacagtcagattgagagcggcctcttg
aaagctgacctgaaagaaaaggtcatgtacaccttgctgaggaagcatcgccaccagacc
aagaagtccaatcttcgctccttagctgacattggcaaaacggtctccagtgcaagtagg
ctgttttccaccccggataatggcagcccaaccactgcacatcgcaacctgacatcaagc
agcctgaacgatatctcagacaagccagagaaagaccagctgaagaacaagttcatgaag
aagctgcccagagatgccgaagcctccaatgttctggttggagaagtggactttctagac
agtccgtttgtggcctttgtgagacttcagcaggctgtgatgttgggggcgctgactgaa
gtgcctgtgcccacaagatttctgttcattcttcttggacccaaaggcaaagccaagtca
taccatgaaatcggtagagcaattgccaccctgatgtcggatgaggtcttccatgaaatt
gcgtataaagccaaggacagacaagatctcctcgctggcattgatgagttcttggatgag
gtcatcgtccttcctcccggagaatgggaccctgccatcaggatagagcctccaaaatcc
ctgccatcctcagataagagaaagaacatgtatgctggaggggacagcacacagatgaat
ggagacactcctcacagcggtgggcacggcggcgggggacacgcagtgggtgacgagctg
aagaagacggggaagttttgtggaggccttattcttgacgtcaaaagaaaagtccctttt
ttcttcagtgatttctacgattcactacacatccagtctttgtctgccattcttttcatc
tatctgggaacagtaaccaatgccatcacgtttggaggactgctgggcgacgccacagaa
aacatgcagggtgtgccggagagttttctaggtacagtggtgactggtgcggtcttctgt
ctcctggccggacaaccattgatcatcctcagcagtacagggccagtactggtgtttgaa
aggctgctcttcaacttcagcagggaaaatgactttgactatctagagtttcgactttgg
attggtctgtggtcggccttcttttgcctagttctggtggccactgatgccagcttcctg
gtgcagtatttcacccgatttacagaagaaggcttttcctcgctgatcagcttcatcttc
atctatgacgctttcaaaaagatgctgaagttggcccattactaccccatcaactcagac
ttcaaaatcgactatgtgacgcagtatgattgcatgtgcatggcgcctactgatgccaat
tcttcagatgtgtacactgatccacttgattcaacgtttgtctggactgtaaattataca
acagatccacgcatgaatgccacctggtcctccttgtcaaagaaggaatgcctgaaatat
ggaggagagctggtgggtaaagcctgtgaatttgtgcccgacatcaccctcatgtccttt
atccttttctttggcacctacacctgctccatgtgtctgaagaaattcaagaccagtccc
ttcttccttactactgtgaggaagctcataagtgactttgctattatcctggccattttg
atcttctgtggtgtcgatgctctggttggggttgaaacaccaaagctcatagtgccaagt
gaatttaagccaacaagcccaaaccgtggctggtttgtgccaccgtttggtggaaacccc
tggtgggtgtacctggcagcgtctgtgccggccctgctggtcaccatcctgctcttcatg
gatcagcagatcaccgctgtcattgtcaatcgcaaggagcacaagcttaagaaaggtgca
ggctatcatctggaccttttctgggtggctgttctgttagcggtgtgctctttcatgggt
ctgccatggtatgtggctgcaacagttatttccatcgcccacattgacagcttgaagatg
gagacagagacctctgccccaggagaacagcccaaattcttaggtgtcagggaacaaaga
gtcactggtgtcatggtcttcattctcactggcatttctgtcttcatgtctccagttctc
aagttcatacccatgccagtgctgtacggagtcttcctttacatgggtgttgcatcactc
aatggcgtgcagtttatggatcggctcaaactgcttctgatgcctgccaaacaccagcca
gacctgatctaccttcgacacgttcctctgagaaaggtccatctcttcacctttgtccag
ctgctctgtctggctcttctctgggtcctcaagtccaccgtggcggccatcatctttcct
gttatgatcttggctctggtagctgtgaggaaggcgctggattatattttctctcagcat
gacctcagcttcctggatgacgtcatacccgagaaggacaagaaaaagaaggaagatgag
aagaaaaagaaaaagaagaagcaagggagcatagacagcgacatggaagattctgactat
ccttacaatgagaatgtccccagcattaaaatcccaatggacatgatggaacaggagcct
tttttaggagataaggcctctgacagagaaaagtccgcttcaatcctggaccgatattca
tcgtgctga

DBGET integrated database retrieval system