KEGG   Danio rerio (zebrafish): 568740
Entry
568740            CDS       T01004                                 

Gene name
slc25a18
Definition
(RefSeq) mitochondrial glutamate carrier 1
  KO
K15107  solute carrier family 25 (mitochondrial glutamate transporter), member 18/22
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dre02000]
    568740 (slc25a18)
Transporters [BR:dre02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   568740 (slc25a18)
SSDB
Motif
Pfam: Mito_carr Telomere_reg-2
Other DBs
NCBI-GeneID: 568740
NCBI-ProteinID: XP_001923807
ZFIN: ZDB-GENE-041111-192
Ensembl: ENSDARG00000070717
Vega: OTTDARG00000039336
UniProt: E7F2B8
Position
25
AA seq 324 aa
MAEKKLSLPAKLINGGVAGLVGVTCVFPIDLAKTRLQNQQGARVYSGMLDCLAKTIKMEG
YFGMYRGAAVNLTLVTPEKAIKLAANDVFRQKLSKDGKLPLWGEILAGCGAGTCQVVVTT
PMEMLKIQLQDAGRLAAQRTVAASAPASGPTPSLVASQTAHPGTSAPPRRSATRITVELL
KTRGLRGLYKGAGATLMRDVPFSMIYFPLFANLNAVGRAEDCKAQERAPFLQSFMAGCMA
GSVAAVAVTPLDVIKTRLQTLQKGEGEDSYRGIIDCAQRILKREGPSAFLKGATCRALVI
APLFGIAQGVYFLGVGEHLIGLLG
NT seq 975 nt   +upstreamnt  +downstreamnt
atggccgaaaagaaactgagcctccctgctaagctgattaatggtggcgtggctggactg
gtgggcgtgacctgtgtgtttcccattgatcttgctaagacccgcctacaaaaccagcag
ggagctcgtgtttatagtggaatgctggactgtttggcaaagacgatcaaaatggagggc
tactttggcatgtatcgaggtgcagctgtgaatctcacacttgtaactccagagaaagcc
atcaaactggctgccaacgacgtcttcaggcagaagctctccaaagatggaaaattacct
ctctggggggagatccttgcaggctgtggggcaggaacctgtcaggtggtagtcaccacc
cccatggaaatgctaaaaatacaactgcaggatgctggcaggctggctgctcagcggact
gtcgctgcctctgcccctgcctccggtccgaccccctccttggttgcctcgcagaccgca
catccaggcaccagtgcaccacctcgccgttcagcaacccggatcacagtggagcttcta
aagacccgaggcctccgggggctttataagggtgcaggtgctacgctgatgagggacgtc
ccgttctccatgatctacttccctctgtttgccaacctcaatgctgtgggccgggcagag
gattgtaaagcccaggagcgggcaccgttcctgcagtcttttatggccggctgcatggca
ggctcagtggcggcggtcgctgtcactcctctggacgttataaagactcgtctacaaaca
ttacagaaaggagaaggagaagactcatacagaggcatcattgactgcgcacagcgcatt
ttaaagcgtgaagggccctcagcgttcctcaagggagcgacgtgtcgagcgctggtcatc
gctccactttttggcattgctcaaggggtctattttctgggcgttggcgaacacctgatt
gggctactgggatag

DBGET integrated database retrieval system