KEGG   Danio rerio (zebrafish): 569065Help
Entry
569065            CDS       T01004                                 

Gene name
dlg5a
Definition
(RefSeq) disks large homolog 5
Organism
dre  Danio rerio (zebrafish)
SSDB OrthologParalogGFIT
Motif
Pfam: dbPDZ_assoc PDZ PDZ_6 Takusan PDZ_2 Guanylate_kin CARD Cep57_CLD_2 SH3_2 SH3_1
Motif
Other DBs
NCBI-GeneID: 569065
NCBI-ProteinID: NP_001139075
ZFIN: ZDB-GENE-030131-3149
Ensembl: ENSDARG00000074059
Vega: OTTDARG00000029586
UniProt: B7ZC95
Position
13
AA seq 1926 aa AA seqDB search
MEPKHKELLHQCHQNLLESITDADRLIELLSKSGSLSEQEAFELDQNCSSSAEKVEQLLK
MLMNKQSDHFLELCVALEKTYPHLYSALFSNGGGPADHHSGTKASSPPPALSDTRPASDS
LDTILFQLKQVTRERDELRKRLALASPGTTFDDCRPNSKPGHDYERLKTQCTKAMADLQS
LQNQHTKTLKRCEEAVKEADYYHIQHSRLLSEQTQLKEEMEVLKRENTKLTREHNHLKQS
CEELRRLHSEDQREVADMRLQQQQVIRENGSSEVLNKLYDTAMDKLEGVKKEYDVLSKRY
SEKVSSHNTDLSRLEQVEEENRRLQKQIDALLKQRDTAIQYQQQWSTSMRRFDSVQQELN
KASAQNKELQREMERLQSEVTRYKNFQLKAVKDGEKYKEERDSVFNEYRLIMSERDQVIK
EVDKLQTELEAAEARLKNTSSERMVASEELEALRQELNSSLVDRDRAICERNELLEKYCH
EVKDKAEAQKELSQACKDIETVREERDVARKERTEAIIQRDQLLREYYQARQKQDSATLD
MERANKEIDILRKQCEAMSQELKEAVQEAEVAKCRRDWAFQERDKIVAERESIRTLCDNL
RRERDRAVSDLADALRNLDDMRKQRNDAARELKELKEKMESQLDKEARFCQLMAHSSHDS
AIDTDSLEWETEVVEFEKDRDDMDLKAMGFDIAEGVNDPYLPGDCGIFVSRVDKGSIADG
RLRVNDWLLKINDVDLTNKDRKQVIKAVLNGGGLINMVVRRRKSLGGRLVTSVHINLIGH
KDAGIALEGGVFVAGIAPGSPAAREGSLTIGDRLIAINGIALDNKSLSECEALLRGGRDS
LALSLMKFFPQSTSGQNIFESLREAEKSNGRIHLTDVHSRNSRNLKHNSSTQTDIYSCDT
AGERRKTRSDAEESLFSERKVFPISTLHPNTLRPASELGPVRYSASAFQEVCYTRSESVG
PECVTLETTLEKKHSGGTWPKMVVGVAMTTDSPAQLSIYRSPKQRKSIFDADTFKRPDTP
SKADYHGPQPLKADSAPTPPTPPTRSDSFKFKHKHQGSSTSESTISAMSISEPKQEDRNG
NLYFSEGKVLSSRKSCEEDIGRMWAEEPEVKRPRPKSAPALRRRMTPQNIPLQSFQSYSN
DGDSVEQREMLRSSPNRPHRHSVGFVPTSYNGTLPPITAVMKNPVYMVRSHRVHTNNCPT
VVSQINQQHTHPSPQHQGQLSLDLSQKRSTDYSESSRSSRASHGTNSLPSSARLGSSNNL
QYRTERIKIPSTPRYPRSILGSDRGSLSHSECSSPSLITPPLSPLNLETSSFASSQSQGS
ISTLPRISVSPVPTEERRKDRPYLEEPRNVMVHKGAEPLGISIVSGENGGIFVSKVTGGS
IAHQAGLEYGDQLLEYNGINLRNATEQQARLIIGQQCDTITIMAQYNPHMYQLGNHSRSS
SRLEPVSTQSTPQGSGTATPDNHSTIDTLSEQDEGTLTPSSKQTTPTTSPNSFIRMPSES
SKKVPEARLVTVRKTQVELGIQLCGGNLRGIFVERLEDDSPARGADAVVPGDMILEYGSV
NMKNKTVEEAYLEMLKPAETVTLRVQHRLDEFNQVKGTPGDGFYIRALYDRVAETELDLS
FKKDDILYVDDTLPNGNFGTWMAWQLDENAQKIQRGQIPSKFMMDQEFYRRHSMTELKDE
TGSSKTLSAAARRSFFRRKHKHKRSSSKDGKDVVALDAISTDSIPFLDDCVSLAYQRVQK
IDCTSPRPVLILGPLVDPVKDMLVKDSPGKFSRCVLEVMKASQQAIERGVKDFLFIDYKR
RSGHFDVTTVASINEITDKDCHCLLDIAPHAIERLHSVHIYPIVIFIRYKNAKQIKEQKD
PIYLRDKVSQKHSKEQFEIAQKIEQDYSKFFTGIVQGGTFPYICTQIVTIVDQEQSKVLW
TPLGSP
NT seq 5781 nt NT seq  +upstreamnt  +downstreamnt
atggagcccaagcacaaagagttactccaccagtgccaccagaacttgctggagtccatc
acggatgctgaccggctgattgagctgctgagtaaatcgggaagcctcagcgagcaggaa
gcgttcgagctggaccagaactgctcctccagcgcagagaaagtggagcagctcctgaag
atgctcatgaacaagcagagcgaccatttcctggagctctgtgtggccctggagaagaca
taccctcacctgtactctgcccttttctccaacggtggaggaccagccgatcatcactct
ggtaccaaagcttcatcacctccacctgcgctcagtgacacccggccggccagtgacagt
ctggacaccatcctcttccagctgaagcaggtcaccagggaaagggacgaacttcgcaag
cgcttggctctcgcctctcctggcaccacctttgatgactgccggccaaattccaaacct
ggtcatgactacgagcgtctgaaaacgcagtgcacgaaggctatggcggacctgcagtct
ttgcagaaccagcacaccaaaactctgaagaggtgcgaggaagccgtgaaagaagcagac
tattaccacatacagcacagccggctcctaagtgaacagacacagttaaaagaggagatg
gaggttttgaaaagagagaacaccaagctgactcgagaacataaccatctgaaacagagc
tgtgaggagctgaggaggcttcattctgaggatcagagggaggtggctgacatgagacta
cagcaacaacaggtaatcagggaaaacggttcatctgaggttttgaacaagctctatgac
acagcgatggacaagctggagggggtgaagaaggaatatgacgtcttgagcaaacggtac
agcgagaaggtgtccagtcacaatacagatctgagtcgactggagcaggtggaggaggag
aacagacgcttgcaaaaacaaatcgacgctctgctcaaacagcgcgatacggccatccag
taccaacagcagtggtctacatctatgaggcggtttgactctgtgcagcaggagctaaat
aaggcctcggcacagaacaaggagctgcagagagagatggagagactccagtcggaggtg
acgcgctacaagaacttccagctgaaggcggtgaaggacggtgagaagtacaaggaggag
cgggattctgtgtttaacgaataccggctaatcatgagcgaaagagaccaggtcattaaa
gaggtggacaagctgcagacggagttggaggctgcagaggcccggctgaaaaacacctct
tctgagaggatggtggccagcgaagagcttgaagctctcagacaggagctaaattcatcg
ctggtggatagagaccgtgccatctgtgagagaaacgagctgttggaaaaatactgccac
gaagtgaaggacaaagcagaggcccagaaagagctgagtcaggcctgtaaagacatcgag
accgtgcgggaggaaagagacgttgccaggaaagagcgaaccgaagccatcatccagaga
gaccagttattgcgtgaatactaccaggcccgacagaaacaagactctgccacattggac
atggagcgtgctaataaagagattgacatattgaggaagcagtgtgaagccatgtctcag
gagctgaaggaggcagtgcaggaggctgaggtggctaagtgtcgcagagattgggccttt
caagagagagacaagattgttgcagagagagagagcatacggacgttgtgtgataacctg
cgtagagagcgagaccgagccgtcagtgatctggccgatgccctacgcaaccttgatgat
atgaggaaacagcgcaatgatgcggccagggaacttaaagagctcaaggagaagatggag
agccagttggacaaggaggcgcgtttctgccagctgatggctcacagctcccatgattca
gccatagacactgattcattagagtgggagactgaagtggtggagtttgagaaggatcgg
gacgacatggatttgaaggcaatggggtttgatatcgcagagggggtgaatgatccatat
ttaccaggagactgtgggatatttgtttctcgggtggacaaaggaagtatcgcggatgga
agattgagggtgaatgattggctgctgaagataaatgatgtggacctgacgaacaaagac
aggaagcaggtcatcaaagctgtacttaatggaggaggcctgatcaatatggtcgttcgc
aggaggaaatctttaggaggaaggctggttacttctgttcacattaatctcatcggacac
aaagacgctggtatagctcttgaaggtggtgtattcgtggctggcatcgcaccgggcagt
ccagctgccagagaaggatctcttaccatcggagaccgcctgattgccataaatgggatc
gctctggataacaaatctctgagtgaatgtgaggctctgctgaggggtggcagggactcg
ctcgctctctctctcatgaagttctttccccagagcacatcaggacagaacatcttcgag
agcctgagggaggcagagaaatccaatggcagaatccacctgacagatgtgcactcacga
aacagcagaaacctcaaacacaacagctccacccagacagacatttacagctgtgacacg
gccggagagagacgaaaaaccagatctgatgcagaggagagccttttttctgaaaggaag
gtcttccccatatccaccttgcacccaaacacactgcgacctgcttcagaactgggacca
gtccgttacagcgccagcgcctttcaggaggtctgctacactcgctcagagtccgtcggc
cctgaatgtgtaacgttggagaccaccttagagaagaaacatagtggcggcacttggccc
aaaatggtggttggtgtcgcgatgaccacggacagcccagcgcagctttccatctacagg
tcacccaaacaaagaaagtccatctttgatgccgataccttcaaacgacctgataccccc
tcaaaagctgattaccatggccctcagcctttaaaagcagactccgcccccacaccccca
accccgcctactcgcagcgactcctttaaattcaagcacaaacatcagggaagctccacc
tccgagtccaccattagtgccatgtccatctctgaacctaagcaggaagatcgtaatggg
aacttgtacttcagtgagggtaaagtcttgagctccaggaagtcctgtgaggaggacatc
ggtcggatgtgggcggaggagcccgaagtgaagcgtcccaggcccaaatcggccccggcc
ctcagacgcaggatgactcctcaaaacattcctctccagagcttccagagttactctaat
gacggtgactccgtggagcagagggagatgctgcgctcctctcctaaccgacctcacaga
cacagcgtgggtttcgtgcctacgtcctataatggaacccttcctcccataacagccgtc
atgaagaaccctgtttacatggtgcgcagtcacagagttcacactaacaactgccctact
gtcgtcagccagatcaatcagcagcacacgcaccccagtcctcagcatcaaggacaactg
agtctggacctaagccagaaacgctccacggactattctgagtcgtcccgtagcagccgg
gcctcacacggcaccaactccctgccgtccagtgcaagactcggttcatcaaacaacttg
cagtatcgcactgaaaggattaagattccctccacaccgcgatatcctcgctctattctg
gggtcagacagagggtccctgtctcattcagaatgcagcagtcccagtctcattactccc
cctctttctcctctcaatctggagacgtcttcgtttgcctccagccagtctcagggctcc
atctccaccctgcccaggatctccgtcagccccgtacccacagaagagcgcagaaaagac
aggccgtacttggaggagccacggaatgttatggtgcacaaaggggcggagcctctcggc
atctccattgtgagtggagagaacggaggaatctttgtctccaaggtgacaggaggcagt
atcgcgcaccaggctgggttggagtatggggaccagctattggagtataatggaataaac
ctgcgcaatgccactgaacagcaagcacgactcatcattggccagcagtgtgacaccatc
acgatcatggcccaatacaacccacacatgtatcagctcggcaaccactcgcgctccagt
tcccgcctggagccagtgagcactcaatccacgccacagggcagtggaactgcaacccca
gataaccactctaccatagacaccctgagtgaacaggatgaaggcacactcaccccatcc
tccaaacagaccacacccacaaccagtcccaacagcttcatcagaatgccgtctgaaagt
tccaagaaagtaccagaggcgcgtttggtgacagtgaggaagactcaggtggagctgggc
attcagctgtgtggaggaaacctgcggggaatcttcgtggagaggctggaagatgacagt
cctgccagaggagcggatgctgttgtacccggggacatgatacttgagtatggctcagtt
aatatgaagaataagactgtggaggaggcatatctggaaatgctgaagcctgcagaaaca
gtgacgttaagagtccagcatcgtctggatgagttcaaccaggtgaaaggcactcctgga
gatggattctatatcagagcactttatgaccgagtagctgagactgagctcgacctctct
tttaagaaagacgacatcctctatgtggacgacacactaccaaatggcaacttcggcacc
tggatggcctggcaacttgacgaaaatgcacaaaaaattcaaagaggccagattcctagc
aaatttatgatggatcaggagttttaccgtagacacagtatgactgaactgaaggacgaa
acgggctccagtaaaaccctctcggctgctgcacgcagatccttcttccgcaggaaacac
aagcacaaacgcagcagctccaaagacgggaaagacgtagtggctttggacgccatcagc
acagactcaattcctttcttagacgactgtgtgagtctggcttatcagagagtgcagaag
attgactgcacatctcccagacctgtgctgatcctcggcccgcttgtggatcctgttaaa
gacatgctggtcaaagattctccagggaaattcagcagatgtgttcttgaggtgatgaag
gcttctcagcaggccattgagcgtggggtcaaagactttctcttcatcgactacaaacga
aggagtggccattttgatgtgacgactgttgcctcaatcaatgaaatcacggacaaggac
tgtcactgtttgcttgacattgcacctcatgctattgaaaggcttcacagcgttcacatt
tacccaatcgtcattttcatacgctacaaaaacgcaaagcagataaaagagcagaaggac
ccgatttatctgcgggataaagtctctcaaaaacattccaaggagcagtttgagattgca
cagaagattgagcaagactacagcaagttcttcacaggtatcgttcagggaggcaccttc
ccttacatttgcactcagatcgtgactattgtggatcaggaacagagcaaagtcttgtgg
actccactgggctctccatag

DBGET integrated database retrieval system